CAPZA2 Antibody - BSA Free

Western Blot: CAPZA2 Antibody [NBP2-58907] - Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.

Immunocytochemistry/Immunofluorescence: CAPZA2 Antibody [NBP2-58907] - Staining of human cell line SiHa shows localization to endoplasmic reticulum.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CAPZA2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CAPZA2 Antibody - BSA Free (NBP2-58907) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: IEGYEDQVLITEHGDLGNGKFLDPKNRICFKFDHLRKEATDPRPCEVENAVESWRTSVETALRAYVKEHYPNGVCTVYGKKIDGQQTIIACIESHQFQA
• Predicted Species: Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CAPZA2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CAPZA2 Antibody - BSA Free

• CAPPA2CAPZ
• capping protein (actin filament) muscle Z-line, alpha 2
• CapZ alpha-2
• F-actin capping protein alpha-2 subunit
• F-actin-capping protein subunit alpha-2

Background

The protein encoded by the CAPZA2 gene is a member of the F-actin capping protein alpha subunit family. It is the alphasubunit of the barbed-end actin binding protein Cap Z. By capping the barbed end of actin filaments, Cap Z regulatesthe growth of the actin filaments at the barbed end. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CAPZA2