BASP1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: BASP1 Antibody [NBP2-14347] - Immunofluorescent staining of human cell line SiHa shows localization to plasma membrane.
Immunohistochemistry-Paraffin: BASP1 Antibody [NBP2-14347] - Staining of human cerebral cortex shows strong positivity in neuropil, neuronal and glial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BASP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MGGKLSKKKKGYNVNDEKAKEKDKKAEGAATEEEGTPKESEP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BASP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
BASP1 Protein (NBP2-14347PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BASP1 Antibody

  • BASP1
  • brain abundant, membrane attached signal protein 1,22 kDa neuronal tissue-enriched acidic protein
  • brain acid-soluble protein 1
  • CAP23
  • CAP-23
  • CAP23brain acid soluble protein 1
  • NAP22
  • NAP-22
  • NAP22MGC8555
  • Neuronal axonal membrane protein NAP-22
  • neuronal tissue-enriched acidic protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-143
Species: Hu, Mu, Rt, Po, Ca, Ch, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NB300-143
Species: Hu, Mu, Rt, Po, Ca, Ch, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF7947
Species: Hu, Mu, Rt
Applications: WB, IHC
PPS010
Species: Hu, Mu, Rt, Bv, Ch, Xp, Ze
Applications: WB
NB110-60011
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P, IP
NBP1-49461
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-Fr, In vivo
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
AF2624
Species: Hu, Mu
Applications: WB, IHC, IP
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF

Publications for BASP1 Antibody (NBP2-14347) (0)

There are no publications for BASP1 Antibody (NBP2-14347).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BASP1 Antibody (NBP2-14347) (0)

There are no reviews for BASP1 Antibody (NBP2-14347). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for BASP1 Antibody (NBP2-14347) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BASP1 Products

BASP1 NBP2-14347

Bioinformatics Tool for BASP1 Antibody (NBP2-14347)

Discover related pathways, diseases and genes to BASP1 Antibody (NBP2-14347). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BASP1 Antibody (NBP2-14347)

Discover more about diseases related to BASP1 Antibody (NBP2-14347).
 

Pathways for BASP1 Antibody (NBP2-14347)

View related products by pathway.

PTMs for BASP1 Antibody (NBP2-14347)

Learn more about PTMs related to BASP1 Antibody (NBP2-14347).

Blogs on BASP1

There are no specific blogs for BASP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BASP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BASP1
Entrez