BASP1 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: BASP1 Antibody [NBP2-14347] - Staining in human cerebral cortex and skeletal muscle tissues using NBP2-14347 antibody. Corresponding BASP1 RNA-seq data are ...read more
Orthogonal Strategies: Western Blot: BASP1 Antibody [NBP2-14347] - Analysis in human cell line HeLa and human cell line A-431.
Immunocytochemistry/ Immunofluorescence: BASP1 Antibody [NBP2-14347] - Staining of human cell line SiHa shows localization to plasma membrane. Antibody staining is shown in green.
Western Blot: BASP1 Antibody [NBP2-14347] - Analysis in control (vector only transfected HEK293T lysate) and BASP1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: BASP1 Antibody [NBP2-14347] - Staining of human cerebral cortex shows strong positivity in neuropil.
Immunohistochemistry-Paraffin: BASP1 Antibody [NBP2-14347] - Staining of human epididymis shows strong membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: BASP1 Antibody [NBP2-14347] - Staining of human placenta shows strong membranous positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: BASP1 Antibody [NBP2-14347] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: BASP1 Antibody [NBP2-14347] - Staining of human tonsil shows strong membranous positivity in germinal center cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

BASP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MGGKLSKKKKGYNVNDEKAKEKDKKAEGAATEEEGTPKESEP
Predicted Species
Mouse (95%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BASP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
BASP1 Protein (NBP2-14347PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BASP1 Antibody

  • BASP1
  • brain abundant, membrane attached signal protein 1,22 kDa neuronal tissue-enriched acidic protein
  • brain acid-soluble protein 1
  • CAP23
  • CAP-23
  • CAP23brain acid soluble protein 1
  • NAP22
  • NAP-22
  • NAP22MGC8555
  • Neuronal axonal membrane protein NAP-22
  • neuronal tissue-enriched acidic protein

Background

The BASP1 gene encodes a membrane bound protein with several transient phosphorylation sites and PEST motifs. Conservation of proteins with PEST sequences among different species supports their functional significance. PEST sequences typically occur in protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-143
Species: Bv, Ca, Ch, Dr, Eq, Hu, Mu, Po, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-14871
Species: Mu, Rt
Applications: ICC/IF, WB
NB120-2860
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-15669
Species: Hu, Mu, Rt
Applications: IHC-WhMt, IHC, WB
NB300-143
Species: Bv, Ca, Ch, Dr, Eq, Hu, Mu, Po, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
AF7947
Species: Hu, Mu, Rt
Applications: ELISA, IHC, Simple Western, WB
NB110-60011
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
NBP1-49461
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, In vitro, In vivo, KD, WB
NBP2-82026
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-32870
Species: Ch, Hu
Applications: IHC, IHC-P, IP, KD, WB
NBP2-15104
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF5866
Species: Hu
Applications: IHC, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
AF2624
Species: Hu, Mu
Applications: IHC, IP, WB
375-TL
Species: Hu
Applications: BA
NB300-223
Species: Bv, Ca, Ch, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB100-82245
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KD, Simple Western, WB
NBP2-14347
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC

Publications for BASP1 Antibody (NBP2-14347) (0)

There are no publications for BASP1 Antibody (NBP2-14347).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BASP1 Antibody (NBP2-14347) (0)

There are no reviews for BASP1 Antibody (NBP2-14347). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for BASP1 Antibody (NBP2-14347) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BASP1 Products

Array NBP2-14347

Diseases for BASP1 Antibody (NBP2-14347)

Discover more about diseases related to BASP1 Antibody (NBP2-14347).
 

Pathways for BASP1 Antibody (NBP2-14347)

View related products by pathway.

PTMs for BASP1 Antibody (NBP2-14347)

Learn more about PTMs related to BASP1 Antibody (NBP2-14347).
 

Research Areas for BASP1 Antibody (NBP2-14347)

Find related products by research area.

Blogs on BASP1

There are no specific blogs for BASP1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BASP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BASP1