CAPRIN2 Antibody - BSA Free

Western Blot: CAPRIN2 Antibody [NBP2-82988] - Host: Rabbit. Target Name: CAPRIN2. Sample Tissue: Human Neurofibroma Tumor lysates. Antibody Dilution: 1ug/ml

Product Discontinued

CAPRIN2 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CAPRIN2. Peptide sequence: SGGPRANSRAGWSDSSQVSSPERDNETFNSGDSGQGDSRSMTPVDVPVTN The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CAPRIN2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for CAPRIN2 Antibody - BSA Free

• caprin family member 2
• FLJ22569
• RNA granule protein 140

Background

CAPRIN2 is involved in regulation of growth as erythroblasts shift from a highly proliferative state towards theirterminal phase of differentiation. Overexpression is associated with increased levels of apoptosis

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CAPRIN2