Cannabinoid R1/CB1/CNR1 Antibody (1F9)

Images

 
Western Blot: Cannabinoid R1/CB1/CNR1 Antibody (1F9) [H00001268-M02] - CNR1 monoclonal antibody (M02), clone 1F9. Analysis of CNR1 expression in rat testis.
Sandwich ELISA: Cannabinoid R1/CB1/CNR1 Antibody (1F9) [H00001268-M02] - Detection limit for recombinant GST tagged CNR1 is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ELISA
Clone
1F9
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Cannabinoid R1/CB1/CNR1 Antibody (1F9) Summary

Immunogen
CNR1 (NP_057167, 1 a.a. - 110 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MKSILDGLADTTFRTITTDLLYVGSNDIQYEDIKGDMASKLGYFPQKFPLTSFRGSPFQEKMTAGDNPQLVPADQVNITEFYNKSLSSFKENEENIQCGENFMDIECFMV
Specificity
CNR1 - cannabinoid receptor 1 (brain) (1F9)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CNR1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Cannabinoid R1/CB1/CNR1 Antibody (1F9)

  • CANN6
  • CANN6CB1R
  • Cannabinoid R1
  • cannabinoid receptor 1 (brain)
  • CannabinoidR1
  • CB1
  • CB1A
  • CB1K5
  • CB1R
  • CB-R
  • CB-RCB1cannabinoid receptor 1
  • central cannabinoid receptor
  • CNR
  • CNR1
  • SKR6R

Background

This gene encodes a protein that is one of two cannabinoid receptors. The cannabinoids, principally delta-9-tetrahydrocannabinol and synthetic analogs, are psychoactive ingredients of marijuana. The cannabinoid receptors are members of the family of guanine-nucleotide-binding protein (G-protein) coupled receptors which inhibit adenylate cyclase activity in a dose-dependent, stereoselective and pertussis toxin-sensitive manner. The two receptors have been found to be involved in the cannabinoid-induced CNS effects (including alterations in mood and cognition) experienced by users of marijuana. Two transcript variants encoding different isoforms have been described for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-606
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00002166-M07
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP2-37957
Species: Hu
Applications: IHC, IHC-P
NB100-1617
Species: Hu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-2307
Species: Hu
Applications: WB
AF5745
Species: Hu
Applications: WB, IHC
AF6387
Species: Hu
Applications: WB
NBP2-57234
Species: Hu
Applications: ICC/IF
NBP2-00735
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-12553
Species: Hu
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF2180
Species: Hu
Applications: WB, Simple Western, IP
NBP1-35641
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA

Publications for Cannabinoid R1/CB1/CNR1 Antibody (H00001268-M02) (0)

There are no publications for Cannabinoid R1/CB1/CNR1 Antibody (H00001268-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cannabinoid R1/CB1/CNR1 Antibody (H00001268-M02) (0)

There are no reviews for Cannabinoid R1/CB1/CNR1 Antibody (H00001268-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cannabinoid R1/CB1/CNR1 Antibody (H00001268-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cannabinoid R1/CB1/CNR1 Products

Bioinformatics Tool for Cannabinoid R1/CB1/CNR1 Antibody (H00001268-M02)

Discover related pathways, diseases and genes to Cannabinoid R1/CB1/CNR1 Antibody (H00001268-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cannabinoid R1/CB1/CNR1 Antibody (H00001268-M02)

Discover more about diseases related to Cannabinoid R1/CB1/CNR1 Antibody (H00001268-M02).
 

Pathways for Cannabinoid R1/CB1/CNR1 Antibody (H00001268-M02)

View related products by pathway.

PTMs for Cannabinoid R1/CB1/CNR1 Antibody (H00001268-M02)

Learn more about PTMs related to Cannabinoid R1/CB1/CNR1 Antibody (H00001268-M02).
 

Research Areas for Cannabinoid R1/CB1/CNR1 Antibody (H00001268-M02)

Find related products by research area.

Blogs on Cannabinoid R1/CB1/CNR1

There are no specific blogs for Cannabinoid R1/CB1/CNR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cannabinoid R1/CB1/CNR1 Antibody (1F9) and receive a gift card or discount.

Bioinformatics

Gene Symbol CNR1
Entrez
Uniprot