Calsequestrin 1 Antibody - BSA Free

Immunohistochemistry-Paraffin: Calsequestrin 1 Antibody [NBP1-88180] - Staining in human skeletal muscle and liver tissues using anti-CASQ1 antibody. Corresponding CASQ1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Calsequestrin 1 Antibody [NBP1-88180] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.

Immunohistochemistry-Paraffin: Calsequestrin 1 Antibody [NBP1-88180] - Staining of human liver shows low expression as expected.

Analysis in control (vector only transfected HEK293T lysate) and CASQ1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells).

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Calsequestrin 1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EHYKAFEDAAEEFHPYIPFFATFDSKVAKKLTLKLNEIDFYEAFMEEPVTIPDKPNSEEEIVNFVEEHRRSTLRKLKPESMYETWE
• Predicted Species: Mouse (97%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CASQ1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Calsequestrin 1 Protein (NBP1-88180PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Calsequestrin 1 Antibody - BSA Free

• calmitin
• calmitine
• calsequestrin 1 (fast-twitch, skeletal muscle)
• Calsequestrin, skeletal muscle isoform
• calsequestrin-1
• CASQ
• PDIB1

Background

The sarcoplasmic reticulum (SR) is, in part, responsible for maintaining the level of intracellular calcium in cardiac and skeletal muscle by storing and releasing calcium. Several intralumenal SR calcium binding proteins have been identified, the most prominent of these is calsequestrin. Calsequstrin is a calcium binding protein known to sequester calcium accumulated in the sarcoplasmic reticulum of muscle cells during relaxation and is found discretely localized to the junctional and corbular (terminal cisternae) SR. Calsequestrin functions to localize calcium near the junctional face of the terminal cisternae from which calcium can be released into the cytosol via the ryanodine receptor. This protein is highly acidic and has a large capacity and moderate to low affinity for calcium.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Calsequestrin 1 Antibody (NBP1-88180)(1)

Publication using NBP1-88180

• Hunt LC, Graca FA, Pagala V Et al. Integrated genomic and proteomic analyses identify stimulus-dependent molecular changes associated with distinct modes of skeletal muscle atrophy Cell reports 2021-11-09 [PMID: 34758314] (WB)

Bioinformatics

• Gene Symbol: CASQ1