Ryanodine Receptor 2 Antibody

Images

 
Immunohistochemistry-Paraffin: Ryanodine Receptor 2 Antibody [NBP1-90091] - Staining of human cerebral cortex shows distinct cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Ryanodine Receptor 2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QDEVRGDGEEGERKPLEAALPSEDLTDLKELTEESDLLSDIFGLDLKREGGQYKLIPHNPNAGLSDLMSNPVPMPEVQEKFQEQKAKEEEKEEKEETKSEPE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RYR2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Ryanodine Receptor 2 Recombinant Protein Antigen (NBP1-90091PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Ryanodine Receptor 2 Antibody

  • ARVC2arrhythmogenic right ventricular dysplasia 2
  • ARVD2
  • Cardiac muscle-type ryanodine receptor
  • hRYR-2
  • ryanodine receptor 2 (cardiac)
  • ryanodine receptor 2
  • RyR2
  • RYR-2
  • VTSIPCardiac muscle ryanodine receptor-calcium release channel

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5745
Species: Hu
Applications: WB, IHC
AF6387
Species: Hu
Applications: WB
NB300-543
Species: Hu, Mu, Rt, Am, Bv, Ca, Ft, Fi, Pm, Rb, Sh
Applications: WB, B/N, IHC, IHC-Fr, IHC-P, IP, IF
NBP1-21398
Species: Hu, Mu
Applications: WB, IHC-P, IP, IF
AF8038
Species: Hu, Mu, Rt
Applications: WB
NB300-542
Species: Hu, Mu, Rt, GP, Rb
Applications: WB, Flow, IHC, IHC-Fr, IHC-P, IP
NBP1-85543
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-98474
Species: Hu
Applications: WB
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-21399
Species: Hu
Applications: WB (-), ICC/IF, IHC-P, IP
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
AF4174
Species: Hu, Mu, Rt
Applications: WB, Simple Western
H00006263-R01
Species: Hu
NBP1-87417
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-581
Species: Hu, Mu, Rt, Po, Am, Ca, GP, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ICC, IF
NBP1-83973
Species: Hu
Applications: IHC, IHC-P
MAB3777
Species: Hu, Mu, Rt
Applications: WB
NBP1-90091
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for Ryanodine Receptor 2 Antibody (NBP1-90091) (0)

There are no publications for Ryanodine Receptor 2 Antibody (NBP1-90091).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ryanodine Receptor 2 Antibody (NBP1-90091) (0)

There are no reviews for Ryanodine Receptor 2 Antibody (NBP1-90091). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Ryanodine Receptor 2 Antibody (NBP1-90091) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Ryanodine Receptor 2 Products

Bioinformatics Tool for Ryanodine Receptor 2 Antibody (NBP1-90091)

Discover related pathways, diseases and genes to Ryanodine Receptor 2 Antibody (NBP1-90091). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ryanodine Receptor 2 Antibody (NBP1-90091)

Discover more about diseases related to Ryanodine Receptor 2 Antibody (NBP1-90091).
 

Pathways for Ryanodine Receptor 2 Antibody (NBP1-90091)

View related products by pathway.

PTMs for Ryanodine Receptor 2 Antibody (NBP1-90091)

Learn more about PTMs related to Ryanodine Receptor 2 Antibody (NBP1-90091).

Blogs on Ryanodine Receptor 2

There are no specific blogs for Ryanodine Receptor 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Ryanodine Receptor 2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RYR2