Ryanodine Receptor 2 Antibody

Images

 
Orthogonal Strategies: Immunohistochemistry-Paraffin: Ryanodine Receptor 2 Antibody [NBP1-90091] - Analysis in human heart muscle and liver tissues. Corresponding RYR2 RNA-seq data are presented for the same ...read more
Immunocytochemistry/ Immunofluorescence: Ryanodine Receptor 2 Antibody [NBP1-90091] - Validation of enriched RYR2 expression in Fezf2+ve IT-PNs by immunohistochemistry. Coronal sections from CTB647 injected Fezf2-Gfp ...read more
Immunohistochemistry-Paraffin: Ryanodine Receptor 2 Antibody [NBP1-90091] - Staining of human heart muscle shows moderate to strong cytoplasmic positivity in cardiomyocytes.
Immunohistochemistry-Paraffin: Ryanodine Receptor 2 Antibody [NBP1-90091] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: Ryanodine Receptor 2 Antibody [NBP1-90091] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: Ryanodine Receptor 2 Antibody [NBP1-90091] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P, IHC-FrFl
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Ryanodine Receptor 2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QDEVRGDGEEGERKPLEAALPSEDLTDLKELTEESDLLSDIFGLDLKREGGQYKLIPHNPNAGLSDLMSNPVPMPEVQEKFQEQKAKEEEKEEKEETKSEPE
Predicted Species
Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RYR2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Immunohistochemistry Free-Floating
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Use in Immunohistochemistry free floating reported in scientific literature (PMID:30483051).
Control Peptide
Ryanodine Receptor 2 Recombinant Protein Antigen (NBP1-90091PEP)
Publications
Read Publication using
NBP1-90091 in the following applications:

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 30483051).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Ryanodine Receptor 2 Antibody

  • arrhythmogenic right ventricular dysplasia 2
  • ARVC2
  • ARVD2
  • cardiac muscle ryanodine receptor-calcium release channel
  • Cardiac muscle-type ryanodine receptor
  • cardiac-type ryanodine receptor
  • hRYR-2
  • islet-type ryanodine receptor
  • kidney-type ryanodine receptor
  • ryanodine receptor 2 (cardiac)
  • ryanodine receptor 2
  • RyR2
  • RYR-2
  • type 2 ryanodine receptor
  • VTSIP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-66861
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF6387
Species: Hu
Applications: WB
NB300-543
Species: Hu, Mu, Rt, Am, Bv, Ca, Ma, Fi, Ma-Mn, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N
NB120-5908
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-32408
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-542
Species: Hu, Mu, Rt, Gp, Rb
Applications: WB, Flow, IHC, IHC-Fr, IHC-P, IP
NBP2-19807
Species: Hu, Mu, Rt, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15669
Species: Hu, Mu, Rt
Applications: WB, IHC
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP3-03498
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-14871
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
AF4174
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-76962
Species: Hu, Mu, Rt
Applications: DB, ELISA, ICC/IF, IHC, IHC-P
NBP1-87417
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-581
Species: Hu, Mu, Rt, Po, Am, Ca, Gp, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-82023
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB300-508
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP1-90091
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IHC-FrFl

Publications for Ryanodine Receptor 2 Antibody (NBP1-90091)(1)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 1 application: IHC-FrFl.


Filter By Application
IHC-FrFl
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for Ryanodine Receptor 2 Antibody (NBP1-90091) (0)

There are no reviews for Ryanodine Receptor 2 Antibody (NBP1-90091). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Ryanodine Receptor 2 Antibody (NBP1-90091) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Ryanodine Receptor 2 Products

Bioinformatics Tool for Ryanodine Receptor 2 Antibody (NBP1-90091)

Discover related pathways, diseases and genes to Ryanodine Receptor 2 Antibody (NBP1-90091). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ryanodine Receptor 2 Antibody (NBP1-90091)

Discover more about diseases related to Ryanodine Receptor 2 Antibody (NBP1-90091).
 

Pathways for Ryanodine Receptor 2 Antibody (NBP1-90091)

View related products by pathway.

PTMs for Ryanodine Receptor 2 Antibody (NBP1-90091)

Learn more about PTMs related to Ryanodine Receptor 2 Antibody (NBP1-90091).

Blogs on Ryanodine Receptor 2

There are no specific blogs for Ryanodine Receptor 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Ryanodine Receptor 2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol RYR2