Orthogonal Strategies: Analysis in human heart muscle and liver tissues using NBP1-90091 antibody. Corresponding RYR2 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Ryanodine Receptor 2 Antibody [NBP1-90091] - Staining of human heart muscle shows moderate to strong cytoplasmic positivity in cardiomyocytes.
Immunohistochemistry-Paraffin: Ryanodine Receptor 2 Antibody [NBP1-90091] - Staining of human liver shows no positivity in hepatocytes as expected.
Immunohistochemistry-Paraffin: Ryanodine Receptor 2 Antibody [NBP1-90091] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: Ryanodine Receptor 2 Antibody [NBP1-90091] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.
Validation of enriched RYR2 expression in Fezf2+ve IT-PNs by immunohistochemistry. Coronal sections from CTB647 injected Fezf2-Gfp mouse were labeled for Ryanodine receptor 2 (RYR2) expression and images captured in M1. ...read more
Novus Biologicals Rabbit Ryanodine Receptor 2 Antibody - BSA Free (NBP1-90091) is a polyclonal antibody validated for use in IHC and ICC/IF. Anti-Ryanodine Receptor 2 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QDEVRGDGEEGERKPLEAALPSEDLTDLKELTEESDLLSDIFGLDLKREGGQYKLIPHNPNAGLSDLMSNPVPMPEVQEKFQEQKAKEEEKEEKEETKSEPE
Predicted Species
Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
RYR2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Dihydropyridine receptor (DHPR) is a surface membrane protein critical for the excitation-contraction coupling of striated muscle. DHPR and the sarcoplasmic reticulum ryanodine receptor (RyR) are two key components of the intracellular junctions, where depolarization of the surface membrane is converted into the release of Ca2+ from internal stores. The alpha1-subunit of the DHPR contains a cytoplasmic loop which is thought to be involved in the interactions with RyR. Phosphorylation of the DHPR alpha1-subunit is also thought to play a role in the functional interaction of DHPR and RyR. Mutation in DHPR alpha1 results in excitation-contraction uncoupling, leading to muscular dysgenesis, a complete inactivity in developing skeletal muscles. Cells that do not express RyR also lack excitation-contraction coupling and exhibit a severalfold reduction in Ca2+ current density.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Reviews for Ryanodine Receptor 2 Antibody (NBP1-90091) (0)
There are no reviews for Ryanodine Receptor 2 Antibody (NBP1-90091).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our Ryanodine Receptor 2 Antibody - BSA Free and receive a gift card or discount.