Calponin 2 Antibody

Images

 
Western Blot: Calponin 2 Antibody [NBP2-13848] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: Calponin 2 Antibody [NBP2-13848] - Immunofluorescent staining of human cell line CACO-2 shows localization to cytosol.
Immunohistochemistry-Paraffin: Calponin 2 Antibody [NBP2-13848] - Staining of human lymph node shows moderate cytoplasmic positivity in germinal and non-germinal center cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Calponin 2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PKYCPQGTVADGAPSGTGDCPDPGEVPEYPPYYQEEAGY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CNN2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Calponin 2 Protein (NBP2-13848PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Calponin 2 Antibody

  • calponin 2
  • Calponin H2, smooth muscle
  • calponin-2
  • Neutral calponin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-53384
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC-P
NB600-1287
Species: Hu, Mu, Rt
Applications: WB, Flow, IP, CyTOF-ready
NB100-74512
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF3377
Species: Mu
Applications: WB, IHC
NBP1-87008
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37620
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-345
Species: Hu
Applications: WB, ChIP, IP
NBP1-87677
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-25151
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP1-31730
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-92208
Species: Hu
Applications: IHC, IHC-P
NBP1-89312
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP1-87926
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16500
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for Calponin 2 Antibody (NBP2-13848) (0)

There are no publications for Calponin 2 Antibody (NBP2-13848).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Calponin 2 Antibody (NBP2-13848) (0)

There are no reviews for Calponin 2 Antibody (NBP2-13848). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Calponin 2 Antibody (NBP2-13848) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Calponin 2 Products

Bioinformatics Tool for Calponin 2 Antibody (NBP2-13848)

Discover related pathways, diseases and genes to Calponin 2 Antibody (NBP2-13848). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Calponin 2 Antibody (NBP2-13848)

Discover more about diseases related to Calponin 2 Antibody (NBP2-13848).
 

Pathways for Calponin 2 Antibody (NBP2-13848)

View related products by pathway.

Blogs on Calponin 2

There are no specific blogs for Calponin 2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Calponin 2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CNN2