Calponin 2 Antibody - BSA Free

Western Blot: Calponin 2 Antibody [NBP2-13848] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Immunocytochemistry/Immunofluorescence: Calponin 2 Antibody [NBP2-13848] - Immunofluorescent staining of human cell line CACO-2 shows localization to cytosol.

Immunohistochemistry-Paraffin: Calponin 2 Antibody [NBP2-13848] - Staining of human lymph node shows moderate cytoplasmic positivity in germinal and non-germinal center cells.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Calponin 2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Calponin 2 Antibody - BSA Free (NBP2-13848) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PKYCPQGTVADGAPSGTGDCPDPGEVPEYPPYYQEEAGY
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CNN2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Calponin 2 Protein (NBP2-13848PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Calponin 2 Antibody - BSA Free

• calponin 2
• Calponin H2, smooth muscle
• calponin-2
• Neutral calponin

Background

Calponin, a 34 kDa protein, regulates smooth muscle cell contraction and is a marker of smooth muscle cell differentiation. Calponin, an actin- and tropomyosin-binding protein, is characterized as an inhibitory factor of smooth-muscle actomyosin activity. Calponin is implicated in the regulation of smooth muscle contraction through its interaction with F-actin and inhibition of the actin-activated MgATPase activity of phosphorylated myosin.Both properties are lost following phosphorylation (primarily at serine 175) by protein kinase C or calmodulin-dependent protein kinase II. The three forms of Calponin, Calponin 1 (basic Calponin), Calponin 2 (neutral Calponin), and Calponin 3 (acidic Calponin) are found in smooth muscle tissue. Additionally, Calponin 2 is found in heart muscle tissue and Calponin 3 is found in the brain.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CNN2