Calmodulin 3 Antibody (1E2.)

Images

 
Immunocytochemistry/ Immunofluorescence: Calmodulin 3 Antibody (1E2) [H00000808-M11] - Analysis of monoclonal antibody to CALM3 on HeLa cell. Antibody concentration 40 ug/ml
Sandwich ELISA: Calmodulin 3 Antibody (1E2) [H00000808-M11] - Detection limit for recombinant GST tagged CALM3 is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
1E2.
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Calmodulin 3 Antibody (1E2.) Summary

Immunogen
CALM3 (NP_005175.2, 53 a.a. - 149 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. INEVDADGNGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK
Specificity
Reacts with calmodulin 3 (phosphorylase kinase, delta).
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CALM3
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
This antibody is reactive against recombinant protein in WB and ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Calmodulin 3 Antibody (1E2.)

  • CALM
  • CALM1
  • CALM2
  • CALML2
  • calmodulin 3 (phosphorylase kinase, delta)
  • calmodulin
  • CAM
  • CAM1
  • CAM2
  • CAM3
  • CAMB
  • CAMC
  • CAMIII
  • PHKD
  • PHKD3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
NBP1-87744
Species: Hu
Applications: WB, IHC, IHC-P
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF7947
Species: Hu, Mu, Rt
Applications: WB, IHC
NB300-500
Species: Hu, Mu, Rt, Po, Am, Bv, Ca, Dr
Applications: WB, IHC, IHC-Fr, IHC-P
NBP1-46183
Species: Hu
Applications: WB, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-86648
Species: Hu
Applications: WB, IHC, IHC-P
H00085366-M01
Species: Hu
Applications: WB, ELISA, RNAi
NBP1-85702
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00000808-M11
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for Calmodulin 3 Antibody (H00000808-M11) (0)

There are no publications for Calmodulin 3 Antibody (H00000808-M11).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Calmodulin 3 Antibody (H00000808-M11) (0)

There are no reviews for Calmodulin 3 Antibody (H00000808-M11). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Calmodulin 3 Antibody (H00000808-M11) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Calmodulin 3 Products

Bioinformatics Tool for Calmodulin 3 Antibody (H00000808-M11)

Discover related pathways, diseases and genes to Calmodulin 3 Antibody (H00000808-M11). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Calmodulin 3 Antibody (H00000808-M11)

Discover more about diseases related to Calmodulin 3 Antibody (H00000808-M11).
 

Pathways for Calmodulin 3 Antibody (H00000808-M11)

View related products by pathway.

PTMs for Calmodulin 3 Antibody (H00000808-M11)

Learn more about PTMs related to Calmodulin 3 Antibody (H00000808-M11).
 

Research Areas for Calmodulin 3 Antibody (H00000808-M11)

Find related products by research area.

Blogs on Calmodulin 3

There are no specific blogs for Calmodulin 3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Calmodulin 3 Antibody (1E2.) and receive a gift card or discount.

Bioinformatics

Gene Symbol CALM3
Entrez
Uniprot