CALML3 Antibody

Images

 
Western Blot: CALML3 Antibody [H00000810-B02P] - Analysis of CALML3 expression in A-431.
Immunocytochemistry/ Immunofluorescence: CALML3 Antibody [H00000810-B02P] - Analysis of purified antibody to CALML3 on HeLa cell. (antibody concentration 10 ug/ml)
Western Blot: CALML3 Antibody [H00000810-B02P] - Analysis of CALML3 expression in transfected 293T cell line by CALML3 polyclonal antibody. Lane 1: CALML3 transfected lysate(16.39 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CALML3 Antibody Summary

Immunogen
CALML3 (NP_005176.1, 1 a.a. - 149 a.a.) full-length human protein. MADQLTEEQVTEFKEAFSLFDKDGDGCITTRELGTVMRSLGQNPTEAELRDMMSEIDRDGNGTVDFPEFLGMMARKMKDTDNEEEIREAFRVFDKDGNGFVSAAELRHVMTRLGEKLSDEEVDEMIRAADTDGDGQVNYEEFVRVLVSK
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
CALML3
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
Application Notes
It has been used for WB and IF.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CALML3 Antibody

  • calmodulin-like 3
  • calmodulin-like protein 3
  • CaM-like protein
  • CLPCalmodulin-related protein NB-1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3667
Species: Hu, Mu
Applications: WB, Simple Western, IHC, ICC
NBP1-89557
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2322
Species: Hu, Mu, Rt, Bv, Ca, Rb, Sh
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, Flow-CS, Flow-IC
NBP2-47415
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP2-12553
Species: Hu
NB120-11867
Species: Hu
Applications: WB, Flow, Func, IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-05164
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-Fr, IHC-P
H00000810-B02P
Species: Hu
Applications: WB, ICC/IF

Publications for CALML3 Antibody (H00000810-B02P) (0)

There are no publications for CALML3 Antibody (H00000810-B02P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CALML3 Antibody (H00000810-B02P) (0)

There are no reviews for CALML3 Antibody (H00000810-B02P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CALML3 Antibody (H00000810-B02P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CALML3 Products

Bioinformatics Tool for CALML3 Antibody (H00000810-B02P)

Discover related pathways, diseases and genes to CALML3 Antibody (H00000810-B02P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CALML3 Antibody (H00000810-B02P)

Discover more about diseases related to CALML3 Antibody (H00000810-B02P).
 

Pathways for CALML3 Antibody (H00000810-B02P)

View related products by pathway.

Blogs on CALML3

There are no specific blogs for CALML3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CALML3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CALML3
Uniprot