Caldesmon/CALD1 Antibody (6M5Q9)

Western Blot: Caldesmon/CALD1 Antibody (6M5Q9) [NBP3-16499] - Western blot analysis of extracts of HeLa cells, using Caldesmon/CALD1 antibody (NBP3-16499) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.

Immunohistochemistry-Paraffin: Caldesmon/CALD1 Antibody (6M5Q9) [NBP3-16499] - Immunohistochemistry of paraffin-embedded human placenta using Caldesmon/CALD1 Rabbit mAb (NBP3-16499) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: Caldesmon/CALD1 Antibody (6M5Q9) [NBP3-16499] - Immunohistochemistry of paraffin-embedded rat ovary using Caldesmon/CALD1 Rabbit mAb (NBP3-16499) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

• Reactivity: Hu
• Applications: WB
• Clone: 6M5Q9
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Caldesmon/CALD1 Antibody (6M5Q9) Summary

• Description: Novus Biologicals Rabbit Caldesmon/CALD1 Antibody (6M5Q9) (NBP3-16499) is a recombinant monoclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 694-793 of human Caldesmon/CALD1 (Q05682). PTKPAASDLPVPAEGVRNIKSMWEKGNVFSSPTAAGTPNKETAGLKVGVSSRINEWLTKTPDGNKSPAPKPSDLRPGDVSSKRNLWEKQSVDKVTSPTKV
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: CALD1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Caldesmon/CALD1 Antibody (6M5Q9)

• CAD
• CALD1
• caldesmon 1
• Caldesmon
• CDM
• CDMH-CAD
• HCAD
• LCAD
• L-CAD
• MGC21352
• NAG22

Background

Caldesmon is a smooth muscle and nonmuscle regulatory protein that interacts with actin, myosin, tropomyosin, and calmodulin (1,2). Smooth muscle caldesmon is an elongated molecule with a calmodulin, tropomyosin, and actin-binding region at the C-terminus and a myosin-binding domain at the N-terminus (3). Caldesmon stimulates actin binding of tropomyosin which increases the stabilization of actin filament structure. In muscle tissues, caldesmon inhibits the actomyosin ATPase by binding to F-actin. This inhibition is reduced by calcium-calmodulin and is promoted by tropomyosin (4).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CALD1