Recombinant Human Calcium-sensing R/CaSR Protein

Images

 
SDS-Page: Recombinant Human Calcium-sensing R/CaSR Protein [H00000846-Q02] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Calcium-sensing R/CaSR Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 21-130 of Human Calcium-sensing R/CaSR

Source: Wheat Germ

Amino Acid Sequence: GPDQRAQKKGDIILGGLFPIHFGVAAKDQDLKSRPESVECIRYNFRGFRWLQAMIFAIEEINSSPALLPNLTLGYRIFDTCNTVSKALEATLSFVAQNKIDSLNLDEFCN

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
CASR
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Calcium-sensing R/CaSR Protein

  • calcium-sensing receptor
  • CAR
  • CaSR
  • EIG8
  • extracellular calcium-sensing receptor
  • FHH
  • FIH
  • GPRC2A
  • GPRC2AHHC
  • HHC1
  • hypocalciuric hypercalcemia 1
  • NSHPT
  • parathyroid Ca(2+)-sensing receptor 1
  • Parathyroid cell calcium-sensing receptor
  • PCaR1
  • PCAR1MGC138441

Background

The protein encoded by this gene is a G protein-coupled receptor that is expressed in the parathyroid hormone (PTH)-producing chief cells of the parathyroid gland, and the cells lining the kidney tubule. It senses small changes in circulating calcium concentration and couples this information to intracellular signaling pathways that modify PTH secretion or renal cation handling, thus this protein plays an essential role in maintaining mineral ion homeostasis. Mutations in this gene cause familial hypocalciuric hypercalcemia, familial, isolated hypoparathyroidism, and neonatal severe primary hyperparathyroidism. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-35212
Species: Hu
NBP2-61816
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
PP-N4111-00
Species: Hu
Applications: WB, IHC, IP
NBP1-86713
Species: Hu
Applications: IHC, IHC-P
AF7356
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready
NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-88192
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01800
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-128
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-29942
Species: Hu, Rt
Applications: WB, Flow, IHC-P
PP-H4537-00
Species: Hu
Applications: WB, IHC, IP, DirELISA
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NB400-153
Species: Hu, Mu
Applications: WB, ICC/IF
MAB1106
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF
H00000846-Q02
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for Calcium-sensing R/CaSR Partial Recombinant Protein (H00000846-Q02) (0)

There are no publications for Calcium-sensing R/CaSR Partial Recombinant Protein (H00000846-Q02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Calcium-sensing R/CaSR Partial Recombinant Protein (H00000846-Q02) (0)

There are no reviews for Calcium-sensing R/CaSR Partial Recombinant Protein (H00000846-Q02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Calcium-sensing R/CaSR Partial Recombinant Protein (H00000846-Q02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for Calcium-sensing R/CaSR Partial Recombinant Protein (H00000846-Q02)

Discover related pathways, diseases and genes to Calcium-sensing R/CaSR Partial Recombinant Protein (H00000846-Q02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Calcium-sensing R/CaSR Partial Recombinant Protein (H00000846-Q02)

Discover more about diseases related to Calcium-sensing R/CaSR Partial Recombinant Protein (H00000846-Q02).
 

Pathways for Calcium-sensing R/CaSR Partial Recombinant Protein (H00000846-Q02)

View related products by pathway.

PTMs for Calcium-sensing R/CaSR Partial Recombinant Protein (H00000846-Q02)

Learn more about PTMs related to Calcium-sensing R/CaSR Partial Recombinant Protein (H00000846-Q02).
 

Research Areas for Calcium-sensing R/CaSR Partial Recombinant Protein (H00000846-Q02)

Find related products by research area.

Blogs on Calcium-sensing R/CaSR

There are no specific blogs for Calcium-sensing R/CaSR, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Calcium-sensing R/CaSR Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CASR
Entrez