Cadherin-6/KCAD Antibody

Images

 
Western Blot: Cadherin-6/KCAD Antibody [NBP1-90347] - Analysis in human cell line EFO-21.
Immunohistochemistry-Paraffin: Cadherin-6/KCAD Antibody [NBP1-90347] - Staining of human fallopian tube shows moderate membranous and cytoplasmic positivity in cells in glandular cells.
Immunohistochemistry-Paraffin: Cadherin-6/KCAD Antibody [NBP1-90347] - Staining of human kidney shows strong membranous positivity in cells in tubules.
Immunohistochemistry-Paraffin: Cadherin-6/KCAD Antibody [NBP1-90347] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.
Immunohistochemistry-Paraffin: Cadherin-6/KCAD Antibody [NBP1-90347] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Cadherin-6/KCAD Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ADVGENAEIEYSITDGEGLDMFDVITDQETQEGIITVKKLLDFEKKKVYTLKVEASNPYVEPRFLYLGPFKDSATVRIVVEDVDEPPVFSKLAYILQIREDAQINTTIGSVTAQDPDAARNP
Predicted Species
Mouse (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CDH6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Cadherin-6/KCAD Protein (NBP1-90347PEP)
Reviewed Applications
Read 1 Review rated 3
using
NBP1-90347 in the following applications:

Publications
Read Publication using NBP1-90347.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Cadherin-6/KCAD Antibody

  • cadherin 6, type 2, K-cadherin (fetal kidney)
  • cadherin, fetal kidney
  • Cadherin6
  • Cadherin-6
  • CDH6
  • KCAD
  • K-cadherin (fetal kidney)
  • K-Cadherin

Background

K Cadherin encodes a type II classical cadherin from the cadherin superfamily. The encoded membrane protein is a calcium dependent cell-cell adhesion glycoprotein comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. Cadherins mediate cell-cell binding in a homophilic manner, contributing to the sorting of heterogeneous cell types and the maintenance of orderly structures such as epithelium. Strong transcriptional expression of this gene has been observed in hepatocellular and renal carcinoma cell lines, suggesting a possible role in metastasis and invasion.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1790
Species: Hu
Applications: IHC, Simple Western, WB
AF748
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
188-C8
Species: Hu
Applications: BA
NBP1-48309
Species: Hu, Mu, Rt
Applications: Flow-IC, Flow, ICC, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NBP2-15723
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-27372
Species: Hu, Ma, Mu
Applications: WB
H00001016-M01
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
6770-CA
Species: Hu
Applications: BA
5604-CA
Species: Hu
Applications: BA
NBP2-20486
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
6510-CA
Species: Hu
Applications: BA
AF4096
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
6774-CA
Species: Hu
Applications: BA
AF7669
Species: Hu, Mu, Rt
Applications: WB
H00028513-B01P
Species: Hu
Applications: WB
314-BP/CF
Species: Hu
Applications: BA, BA
NB100-417
Species: Hu, Mu, Pl, Rt
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, MiAr, PLA, Simple Western, WB
NBP1-90347
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for Cadherin-6/KCAD Antibody (NBP1-90347)(1)

Review for Cadherin-6/KCAD Antibody (NBP1-90347) (1) 31

Average Rating: 3
(Based on 1 review)
We have 1 review tested in 1 species: Mouse.

Reviews using NBP1-90347:
Filter by Applications
Flow
(1)
All Applications
Filter by Species
Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Flow Cytometry Cadherin-6/KCAD NBP1-90347
Enlarge
3
reviewed by:
Verified Customer
Flow Mouse 07/21/2021
View

Summary

ApplicationFlow Cytometry
Sample TestedLiver
SpeciesMouse
Lot000013289

Comments

Comments***Novus Innovators Program - new species or application used on a primary antibody.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cadherin-6/KCAD Antibody (NBP1-90347) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cadherin-6/KCAD Products

Bioinformatics Tool for Cadherin-6/KCAD Antibody (NBP1-90347)

Discover related pathways, diseases and genes to Cadherin-6/KCAD Antibody (NBP1-90347). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cadherin-6/KCAD Antibody (NBP1-90347)

Discover more about diseases related to Cadherin-6/KCAD Antibody (NBP1-90347).
 

Pathways for Cadherin-6/KCAD Antibody (NBP1-90347)

View related products by pathway.

PTMs for Cadherin-6/KCAD Antibody (NBP1-90347)

Learn more about PTMs related to Cadherin-6/KCAD Antibody (NBP1-90347).
 

Research Areas for Cadherin-6/KCAD Antibody (NBP1-90347)

Find related products by research area.

Blogs on Cadherin-6/KCAD

There are no specific blogs for Cadherin-6/KCAD, but you can read our latest blog posts.
Download our IHC Handbook

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

3
5
0
4
0
3
1
2
0
1
0

Verified Customer
07/21/2021
Application: Flow
Species: Mouse

Bioinformatics

Gene Symbol CDH6