Cadherin-6/KCAD Antibody

Images

 
Western Blot: Cadherin-6/KCAD Antibody [NBP1-90347] - Analysis in human cell line EFO-21.
Immunohistochemistry-Paraffin: Cadherin-6/KCAD Antibody [NBP1-90347] - Staining of human kidney shows distinct membranous positivity in cells in tubules.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Cadherin-6/KCAD Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ADVGENAEIEYSITDGEGLDMFDVITDQETQEGIITVKKLLDFEKKKVYTLKVEASNPYVEPRFLYLGPFKDSATVRIVVEDVDEPPVFSKLAYILQIREDAQINTTIGSVTAQDPDAARNP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CDH6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Cadherin-6/KCAD Protein (NBP1-90347PEP)
Publications
Read Publication using NBP1-90347.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Cadherin-6/KCAD Antibody

  • cadherin 6, type 2, K-cadherin (fetal kidney)
  • cadherin, fetal kidney
  • Cadherin6
  • Cadherin-6
  • CDH6
  • KCAD
  • K-cadherin (fetal kidney)
  • K-Cadherin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1790
Species: Hu
Applications: WB, Simple Western, IHC
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-58593
Species: Hu
Applications: WB, ICC/IF
NBP1-48309
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-15723
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-27372
Species: Hu, Mu, Ma
Applications: WB
NBP2-48527
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87584
Species: Hu
Applications: WB, IHC, IHC-P
35740002
Species: Hu
Applications: WB, ELISA
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-19719
Species: Hu
Applications: WB, IHC, IHC-P
AF4096
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
6774-CA
Species: Hu
AF7669
Species: Hu, Mu, Rt
Applications: WB
H00028513-B01P
Species: Hu
Applications: WB, ELISA
NB100-417
Species: Hu, Mu, Rt, Ca, Pl
Applications: WB, Simple Western, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-90347
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for Cadherin-6/KCAD Antibody (NBP1-90347)(1)

Reviews for Cadherin-6/KCAD Antibody (NBP1-90347) (0)

There are no reviews for Cadherin-6/KCAD Antibody (NBP1-90347). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cadherin-6/KCAD Antibody (NBP1-90347) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cadherin-6/KCAD Products

Bioinformatics Tool for Cadherin-6/KCAD Antibody (NBP1-90347)

Discover related pathways, diseases and genes to Cadherin-6/KCAD Antibody (NBP1-90347). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cadherin-6/KCAD Antibody (NBP1-90347)

Discover more about diseases related to Cadherin-6/KCAD Antibody (NBP1-90347).
 

Pathways for Cadherin-6/KCAD Antibody (NBP1-90347)

View related products by pathway.

PTMs for Cadherin-6/KCAD Antibody (NBP1-90347)

Learn more about PTMs related to Cadherin-6/KCAD Antibody (NBP1-90347).

Blogs on Cadherin-6/KCAD

There are no specific blogs for Cadherin-6/KCAD, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cadherin-6/KCAD Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CDH6
Entrez