Cadherin-6/KCAD Antibody - BSA Free

Immunohistochemistry-Paraffin: Cadherin-6/KCAD Antibody [NBP1-87588] - Staining in human kidney and lymph node tissues using anti-CDH6 antibody. Corresponding CDH6 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: Cadherin-6/KCAD Antibody [NBP1-87588] - Staining of human lymph node shows low expression as expected.

Immunohistochemistry-Paraffin: Cadherin-6/KCAD Antibody [NBP1-87588] - Staining of human kidney shows high expression.

Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Cadherin-6/KCAD Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Cadherin-6/KCAD Antibody - BSA Free (NBP1-87588) is a polyclonal antibody validated for use in IHC. Anti-Cadherin-6/KCAD Antibody: Cited in 2 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LDRETLLWHNITVIATEINNPKQSSRVPLYIKVLDVNDNAPEFAEFYETFVCEKAKADQLIQTLHAVDKDDPYSGHQFSFSLAPEAASGSNFTIQDNKDNTAGILTRKNGYNRHEMSTYLLP
• Predicted Species: Mouse (98%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CDH6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: HIER pH6 retrieval is recommended.
• Control Peptide:

  Cadherin-6/KCAD Protein (NBP1-87588PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Cadherin-6/KCAD Antibody - BSA Free

• cadherin 6, type 2, K-cadherin (fetal kidney)
• cadherin, fetal kidney
• Cadherin6
• Cadherin-6
• CDH6
• KCAD
• K-cadherin (fetal kidney)
• K-Cadherin

Background

K Cadherin encodes a type II classical cadherin from the cadherin superfamily. The encoded membrane protein is a calcium dependent cell-cell adhesion glycoprotein comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. Cadherins mediate cell-cell binding in a homophilic manner, contributing to the sorting of heterogeneous cell types and the maintenance of orderly structures such as epithelium. Strong transcriptional expression of this gene has been observed in hepatocellular and renal carcinoma cell lines, suggesting a possible role in metastasis and invasion.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Cadherin-6/KCAD Antibody (NBP1-87588)(2)

Publications using NBP1-87588

• Takasato M, Er PX, Becroft M et al. Directing human embryonic stem cell differentiation towards a renal lineage generates a self-organizing kidney. Nat Cell Biol 2014-01-01 [PMID: 24335651]
• Sancisi V, Gandolfi G, Ragazzi M et al. Cadherin 6 Is a New RUNX2 Target in TGF--beta Signalling Pathway. PLoS One 2013-01-01 [PMID: 24069422]

Bioinformatics

• Gene Symbol: CDH6