Cadherin-6/KCAD Antibody (5N2K3) Summary
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 691-790 of human Cadherin-6/KCAD (P55285). DIVPEALFLPRRTPTARDNTDVRDFINQRLKENDTDPTAPPYDSLATYAYEGTGSVADSLSSLESVTTDADQDYDYLSDWGPRFKKLADMYGGVDSDKDS |
| Source |
HEK293 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
CDH6 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Western Blot 1:1000 - 1:5000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Cadherin-6/KCAD Antibody (5N2K3)
Background
K Cadherin encodes a type II classical cadherin from the cadherin superfamily. The encoded membrane protein is a calcium dependent cell-cell adhesion glycoprotein comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. Cadherins mediate cell-cell binding in a homophilic manner, contributing to the sorting of heterogeneous cell types and the maintenance of orderly structures such as epithelium. Strong transcriptional expression of this gene has been observed in hepatocellular and renal carcinoma cell lines, suggesting a possible role in metastasis and invasion.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, ICC, IHC, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: BA, BA
Species: Hu, Mu, Pl, Rt
Applications: ChIP, Dual ISH-IHC, ELISA, Flow, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, MiAr, PLA, Simple Western, WB
Species: Hu, Mu, Rt
Applications: WB
Publications for Cadherin-6/KCAD Antibody (NBP3-16464) (0)
There are no publications for Cadherin-6/KCAD Antibody (NBP3-16464).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Cadherin-6/KCAD Antibody (NBP3-16464) (0)
There are no reviews for Cadherin-6/KCAD Antibody (NBP3-16464).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Cadherin-6/KCAD Antibody (NBP3-16464) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Cadherin-6/KCAD Products
Research Areas for Cadherin-6/KCAD Antibody (NBP3-16464)
Find related products by research area.
|
Blogs on Cadherin-6/KCAD