Cadherin-22 Antibody

Images

 
Western Blot: Cadherin-22 Antibody [NBP2-84581] - WB Suggested Anti-CDH22 Antibody. Titration: 1.0 ug/ml. Positive Control: Hela Whole Cell

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Cadherin-22 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Cadherin-22. Peptide sequence: LIDELTGDIHAMERLDREQKTFYTLRAQARDRATNRLLEPESEFIIKVQD The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
CDH22
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Cadherin-22 Antibody

  • C20orf25
  • cadherin 22, type 2
  • cadherin-22
  • cadherin-like 22
  • dJ998H6.1
  • MGC39564
  • ortholog of rat PB-cadherin
  • PB-cadherin
  • Pituitary and brain cadherin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

355-BM/CF
Species: Hu, Mu, Rt
Applications: BA
MAB2240
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
NB100-879
Species: Hu
Applications: ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NBP2-59451
Species: Hu
Applications: ELISA, Flow, ICC/IF, MiAr, WB
MAB3219
Species: Hu, Mu, Rt
Applications: WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NB600-1287
Species: Ca, Hu, Mu, Rb, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, WB
NB110-92756
Species: Ch, Hu, Mu, Re
Applications: KD, WB
AF1979
Species: Hu
Applications: ICC, IHC, Simple Western, WB
H00023316-M03
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, WB
NBP3-13161
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89679
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB100-2600
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-51575
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
MAB1790
Species: Hu
Applications: IHC, Simple Western, WB
NBP2-00932
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-15184
Species: Hu, Rt
Applications: Flow-CS, Flow, ICC/IF, IHC, IHC-P, Simple Western
NBP1-90347
Species: Hu
Applications: IHC, IHC-P, WB

Publications for Cadherin-22 Antibody (NBP2-84581) (0)

There are no publications for Cadherin-22 Antibody (NBP2-84581).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cadherin-22 Antibody (NBP2-84581) (0)

There are no reviews for Cadherin-22 Antibody (NBP2-84581). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cadherin-22 Antibody (NBP2-84581) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cadherin-22 Products

Bioinformatics Tool for Cadherin-22 Antibody (NBP2-84581)

Discover related pathways, diseases and genes to Cadherin-22 Antibody (NBP2-84581). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cadherin-22 Antibody (NBP2-84581)

Discover more about diseases related to Cadherin-22 Antibody (NBP2-84581).
 

Pathways for Cadherin-22 Antibody (NBP2-84581)

View related products by pathway.

PTMs for Cadherin-22 Antibody (NBP2-84581)

Learn more about PTMs related to Cadherin-22 Antibody (NBP2-84581).

Blogs on Cadherin-22

There are no specific blogs for Cadherin-22, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cadherin-22 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CDH22