Cadherin-17 Recombinant Protein Antigen

Images

 
There are currently no images for Cadherin-17 Protein (NBP1-88238PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Cadherin-17 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CDH17.

Source: E. coli

Amino Acid Sequence: HPIKITQVRWNDPGAQYSLVDKEKLPRFPFSIDQEGDIYVTQPLDREEKDAYVFYAVAKDEYGKPLSYPLEIHVKVK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CDH17
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88238.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Cadherin-17 Recombinant Protein Antigen

  • cadherin 17, LI cadherin (liver-intestine)
  • cadherin
  • cadherin-16
  • Cadherin17
  • Cadherin-17
  • CDH16
  • CDH17
  • FLJ26931
  • HPT-1 cadherin
  • HPT1
  • HPT-1
  • human intestinal peptide-associated transporter HPT-1
  • human peptide transporter 1
  • Intestinal peptide-associated transporter HPT-1
  • LI cadherin
  • LI-cadherin
  • Liver-intestine cadherin
  • MGC138218
  • MGC142024

Background

LI Cadherin is a member of the cadherin superfamily, genes encoding calcium-dependent, membrane-associated glycoproteins. The encoded protein is cadherin-like, consisting of an extracellular region, containing 7 cadherin domains, and a transmembrane region but lacking the conserved cytoplasmic domain. The protein is a component of the gastrointestinal tract and pancreatic ducts, acting as an intestinal proton-dependent peptide transporter in the first step in oral absorption of many medically important peptide-based drugs. The protein may also play a role in the morphological organization of liver and intestine.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92005
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NB100-2136
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB (-)
AF748
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, ICC, IHC, Simple Western, WB
NB120-11197
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF (-), IHC, IHC-Fr,  IHC-P, WB
NBP2-34062
Species: Hu
Applications: IHC,  IHC-P, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NBP2-15196
Species: Bv(-), Ch, Fe, Hu, Ma, Pm, Mu, Po, Rb, Rt
Applications: DB, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP1-32914
Species: Hu, Mu
Applications: ICC/IF, IHC, WB
DPG00
Species: Hu
Applications: ELISA
NBP2-34200
Species: Hu
Applications: IHC,  IHC-P, WB
AF1329
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
DMP900
Species: Hu
Applications: ELISA
236-EG
Species: Hu
Applications: BA
BBA10
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, KO, Simple Western, WB
NBP1-86380
Species: Hu
Applications: ICC/IF, WB
NBP1-88238PEP
Species: Hu
Applications: AC

Publications for Cadherin-17 Protein (NBP1-88238PEP) (0)

There are no publications for Cadherin-17 Protein (NBP1-88238PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cadherin-17 Protein (NBP1-88238PEP) (0)

There are no reviews for Cadherin-17 Protein (NBP1-88238PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Cadherin-17 Protein (NBP1-88238PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Cadherin-17 Products

Research Areas for Cadherin-17 Protein (NBP1-88238PEP)

Find related products by research area.

Blogs on Cadherin-17

There are no specific blogs for Cadherin-17, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Cadherin-17 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CDH17