Recombinant Human Cadherin-17 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Cadherin-17 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1-108 of Human CDH17 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:EGKFSGPLKPMTFSIYEGQEPSQIIFQFKANPPAVTFELTGETDNIFVIEREGLLYYNRALDRETRSTHNLQVAALDANGIIVEGPVPITIEVKDINDNRPTFLQSKY

Protein/Peptide Type
Partial Recombinant Protein
Gene
CDH17

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Cadherin-17 Protein

  • cadherin 17, LI cadherin (liver-intestine)
  • cadherin
  • cadherin-16
  • Cadherin17
  • Cadherin-17
  • CDH16
  • CDH17
  • FLJ26931
  • HPT-1 cadherin
  • HPT1
  • HPT-1
  • human intestinal peptide-associated transporter HPT-1
  • human peptide transporter 1
  • Intestinal peptide-associated transporter HPT-1
  • LI cadherin
  • LI-cadherin
  • Liver-intestine cadherin
  • MGC138218
  • MGC142024

Background

CDH17 - cadherin 17, LI cadherin (liver-intestine)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92005
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-2136
Species: Hu
Applications: IHC, IHC-P, IP
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB120-11197
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-Fr, IHC-P
NB100-1844
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-15196
Species: Hu, Mu, Rt, Po, Ch, Fe, Pm, Rb, Bv(-)
Applications: Flow, ICC/IF, IHC-Fr, IHC-P, Flow-IC
NBP2-13980
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34200
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-86380
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC

Publications for Cadherin-17 Partial Recombinant Protein (H00001015-Q01) (0)

There are no publications for Cadherin-17 Partial Recombinant Protein (H00001015-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cadherin-17 Partial Recombinant Protein (H00001015-Q01) (0)

There are no reviews for Cadherin-17 Partial Recombinant Protein (H00001015-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cadherin-17 Partial Recombinant Protein (H00001015-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Cadherin-17 Products

Bioinformatics Tool for Cadherin-17 Partial Recombinant Protein (H00001015-Q01)

Discover related pathways, diseases and genes to Cadherin-17 Partial Recombinant Protein (H00001015-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cadherin-17 Partial Recombinant Protein (H00001015-Q01)

Discover more about diseases related to Cadherin-17 Partial Recombinant Protein (H00001015-Q01).
 

Pathways for Cadherin-17 Partial Recombinant Protein (H00001015-Q01)

View related products by pathway.

PTMs for Cadherin-17 Partial Recombinant Protein (H00001015-Q01)

Learn more about PTMs related to Cadherin-17 Partial Recombinant Protein (H00001015-Q01).
 

Research Areas for Cadherin-17 Partial Recombinant Protein (H00001015-Q01)

Find related products by research area.

Blogs on Cadherin-17

There are no specific blogs for Cadherin-17, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Cadherin-17 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CDH17
Entrez