CACNG4 Antibody (NBP2-55176)

Images

 
Immunohistochemistry-Paraffin: CACNG4 Antibody [NBP2-55176] - Immunohistochemical staining of human cerebral cortex shows weak positivity in neuropil.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CACNG4 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TDYWLYSSAHICNGTNLTMDDGPPPRRARGDLTHSGLWRVCCIEGIYKGHCFRINHFPEDNDYDHDSSEYLLRIVRASSV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CACNG4
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
This product has been validated for use in IHC-Paraffin Embedded Tissues. HIER pH6 antigen retrieval is recommended.
Control Peptide
CACNG4 Recombinant Protein Antigen (NBP2-55176PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, pH 7.2, containing 40% glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for CACNG4 Antibody

  • calcium channel, voltage-dependent, gamma subunit 4
  • MGC11138
  • MGC24983
  • neuronal voltage-gated calcium channel gamma-4 subunit
  • TARP gamma-4
  • transmembrane AMPAR regulatory protein gamma-4
  • voltage-dependent calcium channel gamma-4 subunit

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86228
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-22411
Species: Rt
Applications: WB, ICC/IF
NBP1-74080
Species: Hu
Applications: WB
PPS007
Species: Hu, Mu, Rt, Ca, Ch
Applications: WB
NBP2-14432
Species: Hu
Applications: IHC, IHC-P
H00000786-B01P
Species: Hu
Applications: WB, Flow
NBP1-30699
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
H00010368-M01
Species: Hu, Rt
Applications: WB, ELISA
PPS050
Species: Hu, Mu, Rt, Ch, Pm, Ze
Applications: WB
NBP1-46170
Species: Hu
Applications: WB, IHC-P, IP
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP2-55775
Species: Hu
Applications: WB, ICC/IF
NBP1-80910
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF7899
Species: Hu
Applications: WB, IHC
NBP1-32663
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84212
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32972
Species: Hu, Mu, Rt, Ch, Pm, Sh
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
AF175
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, Neut

Publications for CACNG4 Antibody (NBP2-55176) (0)

There are no publications for CACNG4 Antibody (NBP2-55176).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CACNG4 Antibody (NBP2-55176) (0)

There are no reviews for CACNG4 Antibody (NBP2-55176). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CACNG4 Antibody (NBP2-55176) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CACNG4 Products

Related Products by Gene

Bioinformatics Tool for CACNG4 Antibody (NBP2-55176)

Discover related pathways, diseases and genes to CACNG4 Antibody (NBP2-55176). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CACNG4 Antibody (NBP2-55176)

Discover more about diseases related to CACNG4 Antibody (NBP2-55176).
 

Pathways for CACNG4 Antibody (NBP2-55176)

View related products by pathway.

PTMs for CACNG4 Antibody (NBP2-55176)

Learn more about PTMs related to CACNG4 Antibody (NBP2-55176).

Blogs on CACNG4

There are no specific blogs for CACNG4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CACNG4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CACNG4