CACNA2D4 Antibody


Western Blot: CACNA2D4 Antibody [NBP1-68992] - Titration: 0.2-1 ug/ml, Positive Control: 293T cell lysate.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

CACNA2D4 Antibody Summary

Synthetic peptides corresponding to CACNA2D4 (calcium channel, voltage-dependent, alpha 2/delta subunit 4) The peptide sequence was selected from the C terminal of CACNA2D4. Peptide sequence MAFLGTRAGLLRSSLFVGSEKVSDRKFLTPEDEASVFTLDRFPLWYRQ
This product is specific to Subunit or Isoform: alpha-2/delta-4.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against CACNA2D4 and was validated on Western blot.
Theoretical MW
128 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CACNA2D4 Antibody

  • calcium channel, voltage-dependent, alpha 2/delta subunit 4
  • RCD4
  • voltage-dependent calcium channel subunit alpha-2/delta-4
  • voltage-gated calcium channel alpha(2)delta-4 subunit
  • Voltage-gated calcium channel subunit alpha-2/delta-4


This gene encodes a member of the alpha-2/delta subunit family, a protein in the voltage-dependent calcium channel complex. Calcium channels mediate the influx of calcium ions into the cell upon membrane polarization and consist of a complex of alpha-1, alpha-2/delta, beta, and gamma subunits in a 1:1:1:1 ratio. Various versions of each of these subunits exist, either expressed from similar genes or the result of alternative splicing. Research on a highly similar protein in rabbit suggests the protein described in this record is cleaved into alpha-2 and delta subunits. Alternate transcriptional splice variants of this gene have been observed but have not been thoroughly characterized.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu, Rt
Applications: WB, ICC/IF, IHC-Fr
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Bv, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P
Species: Hu
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA
Species: Hu
Applications: WB, Flow, ICC/IF
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt, Mk
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC-Fr
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for CACNA2D4 Antibody (NBP1-68992) (0)

There are no publications for CACNA2D4 Antibody (NBP1-68992).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CACNA2D4 Antibody (NBP1-68992) (0)

There are no reviews for CACNA2D4 Antibody (NBP1-68992). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CACNA2D4 Antibody (NBP1-68992) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CACNA2D4 Products

Bioinformatics Tool for CACNA2D4 Antibody (NBP1-68992)

Discover related pathways, diseases and genes to CACNA2D4 Antibody (NBP1-68992). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CACNA2D4 Antibody (NBP1-68992)

Discover more about diseases related to CACNA2D4 Antibody (NBP1-68992).

Pathways for CACNA2D4 Antibody (NBP1-68992)

View related products by pathway.

PTMs for CACNA2D4 Antibody (NBP1-68992)

Learn more about PTMs related to CACNA2D4 Antibody (NBP1-68992).

Research Areas for CACNA2D4 Antibody (NBP1-68992)

Find related products by research area.

Blogs on CACNA2D4

There are no specific blogs for CACNA2D4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CACNA2D4 Antibody and receive a gift card or discount.


Gene Symbol CACNA2D4