Recombinant Human CAC1 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human CAC1 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 111-210 of Human CAC1

Source: Wheat Germ

Amino Acid Sequence: STININTSTSKFLMNVITIEDYKSTYWPKLDGAIDQLLTQSPGDYIPISYEQIYSCVYKCVCQQHSEQMYSDLIKKITNHLERVSKELQASPPDLYIERF

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
CACUL1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CAC1 Protein

  • C10orf46
  • CDK2-associated, cullin domain 1
  • chromosome 10 open reading frame 46
  • cullin
  • FLJ40409
  • MGC33215

Background

C10orf46 - chromosome 10 open reading frame 46

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF2574
Species: Hu
Applications: CyTOF-ready, ICFlow
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB120-1868
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP2-37523
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
NBP2-37539
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-88742
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-31363
Species: Hu
Applications: WB, ICC/IF
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP1-84407
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-58788
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
AF2769
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-49873
Species: Hu, Mu
Applications: WB, IHC, IHC-P, PEP-ELISA
H00055832-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB120-495
Species: Hu, Mu, Rt, Dr
Applications: WB, ICC/IF, IHC, IP
NBP1-22970
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
H00143384-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for CAC1 Partial Recombinant Protein (H00143384-Q01) (0)

There are no publications for CAC1 Partial Recombinant Protein (H00143384-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CAC1 Partial Recombinant Protein (H00143384-Q01) (0)

There are no reviews for CAC1 Partial Recombinant Protein (H00143384-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CAC1 Partial Recombinant Protein (H00143384-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CAC1 Products

Bioinformatics Tool for CAC1 Partial Recombinant Protein (H00143384-Q01)

Discover related pathways, diseases and genes to CAC1 Partial Recombinant Protein (H00143384-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Research Areas for CAC1 Partial Recombinant Protein (H00143384-Q01)

Find related products by research area.

Blogs on CAC1

There are no specific blogs for CAC1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CAC1 Antibody
H00143384-B01P

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CAC1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CACUL1