Recombinant Human CABYR Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human CABYR Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-379 of Human CABYR full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MISSKPRLVVPYGLKTLLEGISRAVLKTNPSNINQFAAAYFQELTMYRGNTTMDIKDLVKQFHQIKVEKWSEGTTPQKKLECLKEPGKTSVESKVPTQMEKSTDTDEDNVTRTEYSDKTTQFPSVYAVPGTEQTEAVGGLSSKPATPKTTTPPSSPPPTAVSPEFAYVPADPAQLAAQMLAMATSERGQPPPCSNMWTLYCLTDKNQQGHPSPPPAPGPFPQATLYLPNPKDPQFQQHPPKVTFPTYVMGDTKKTSAPPFILVGSNVQEAQGWKPLPGHAVVSQSDVLRYVAMQVPIAVPADEKYQKHTLSPQNANPPSGQDVPRPKSPVFLSVAFPVEDVAKKSSGSGDKCAPFGSYGIAGEVTVTTAHKRRKAETEN

Protein/Peptide Type
Recombinant Protein
Gene
CABYR

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CABYR Protein

  • CABYRa
  • CABYRc
  • calcium binding tyrosine-(Y)-phosphorylation regulated
  • Calcium-binding protein 86
  • calcium-binding tyrosine-(Y)-phosphorylation regulated (fibrousheathin 2)
  • Cancer/testis antigen 88
  • CBP86CABYRc/d
  • CT88MGC9117
  • fibrousheathin 2
  • Fibrousheathin II
  • fibrousheathin-2
  • FSP-2calcium binding tyrosine-(Y)-phosphorylation regulated (fibrousheathin 2)
  • FSP2calcium-binding tyrosine phosphorylation-regulated protein
  • Testis-specific calcium-binding protein CBP86

Background

To reach fertilization competence, spermatozoa undergo a series of morphological and molecular maturational processes, termed capacitation, involving protein tyrosine phosphorylation and increased intracellular calcium. The protein encoded by this gene localizes to the principal piece of the sperm flagellum in association with the fibrous sheath and exhibits calcium-binding when phosphorylated during capacitation. A pseudogene on chromosome 3 has been identified for this gene. Transcript variants of this gene encode multiple protein isoforms. An additional transcript and isoform has not been fully characterized. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

21050002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-85409
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56418
Species: Hu
Applications: IHC, IHC-P
NBP1-89173
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00051062-M03
Species: Hu, Rt
Applications: WB, ELISA
NBP2-36431
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-53818
Species: Hu, Mu, Rt, Po, Bv, Pm, Xp, Ze
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-14040
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31754
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89172
Species: Hu
Applications: WB, IHC, IHC-P
9094-AG
Species: Hu
NBP1-90271
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02149
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-47470
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P

Publications for CABYR Recombinant Protein (H00026256-P01) (0)

There are no publications for CABYR Recombinant Protein (H00026256-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CABYR Recombinant Protein (H00026256-P01) (0)

There are no reviews for CABYR Recombinant Protein (H00026256-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CABYR Recombinant Protein (H00026256-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CABYR Products

Bioinformatics Tool for CABYR Recombinant Protein (H00026256-P01)

Discover related pathways, diseases and genes to CABYR Recombinant Protein (H00026256-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CABYR Recombinant Protein (H00026256-P01)

Discover more about diseases related to CABYR Recombinant Protein (H00026256-P01).
 

Pathways for CABYR Recombinant Protein (H00026256-P01)

View related products by pathway.

PTMs for CABYR Recombinant Protein (H00026256-P01)

Learn more about PTMs related to CABYR Recombinant Protein (H00026256-P01).
 

Research Areas for CABYR Recombinant Protein (H00026256-P01)

Find related products by research area.

Blogs on CABYR

There are no specific blogs for CABYR, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ATG5 Antibody
NB110-53818
CABYR Antibody
NBP2-14430

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CABYR Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CABYR