CABC1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: CABC1 Antibody [NBP2-56006] - Staining of human cell line Hep G2 shows localization to mitochondria.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CABC1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LGDTIMVAKGLVKLTQAAVETHLQHLGIGGELIMAARALQSTAVEQIGMFLGKVQGQDKHEEYFAENFGGPEGEFHFSVPHAAG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
COQ8A
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CABC1 Recombinant Protein Antigen (NBP2-56006PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for CABC1 Antibody

  • aarF domain containing kinase 3
  • chaperone, ABC1 activity of bc1 complex homolog (S. pombe)
  • chaperone, ABC1 activity of bc1 complex homolog
  • chaperone, ABC1 activity of bc1 complex like (S. pombe)
  • chaperone-ABC1 (activity of bc1 complex, S.pombe)-like
  • Chaperone-ABC1-like
  • coenzyme Q8 homolog
  • EC 2.7.11
  • EC 2.7.11.-
  • MGC4849
  • mitochondrial
  • SCAR9

Background

CABC1 encodes a mitochondrial protein similar to yeast ABC1, which functions in an electron-transferring membrane protein complex in the respiratory chain. It is not related to the family of ABC transporter proteins. Expression of this gene is induced by the tumor suppressor p53 and in response to DNA damage, and inhibiting its expression partially suppresses p53-induced apoptosis. Alternatively spliced transcript variants have been found; however, their full-length nature has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CABC1 Antibody (NBP2-56006) (0)

There are no publications for CABC1 Antibody (NBP2-56006).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CABC1 Antibody (NBP2-56006) (0)

There are no reviews for CABC1 Antibody (NBP2-56006). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for CABC1 Antibody (NBP2-56006) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CABC1 Products

Research Areas for CABC1 Antibody (NBP2-56006)

Find related products by research area.

Blogs on CABC1

There are no specific blogs for CABC1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CABC1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol COQ8A