VRK3 Antibody


Immunocytochemistry/ Immunofluorescence: VRK3 Antibody [NBP2-58572] - Staining of human cell line A549 shows localization to nucleus, nucleoli & vesicles.
Immunohistochemistry-Paraffin: VRK3 Antibody [NBP2-58572] - Immunohistochemical staining of human duodenum shows moderate nuclear and weak cytoplasmic positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

VRK3 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: CPYCGNSLPVEEHVGSQTFVNPHVSSFQGSKRGLNSSFETSPKKVKWSSTVTSPRLSLFSDGDSSESEDTLSS
Specificity of human VRK3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
VRK3 Recombinant Protein Antigen (NBP2-58572PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS, pH 7.2, containing 40% glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for VRK3 Antibody

  • inactive serine/threonine-protein kinase VRK3
  • serine/threonine-protein kinase VRK3
  • Serine/threonine-protein pseudokinase VRK3
  • vaccinia related kinase 3
  • Vaccinia-related kinase 3


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt, Ze
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, RNAi
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow

Publications for VRK3 Antibody (NBP2-58572) (0)

There are no publications for VRK3 Antibody (NBP2-58572).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for VRK3 Antibody (NBP2-58572) (0)

There are no reviews for VRK3 Antibody (NBP2-58572). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for VRK3 Antibody (NBP2-58572) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for VRK3 Antibody (NBP2-58572)

Discover related pathways, diseases and genes to VRK3 Antibody (NBP2-58572). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for VRK3 Antibody (NBP2-58572)

Discover more about diseases related to VRK3 Antibody (NBP2-58572).

Pathways for VRK3 Antibody (NBP2-58572)

View related products by pathway.

PTMs for VRK3 Antibody (NBP2-58572)

Learn more about PTMs related to VRK3 Antibody (NBP2-58572).

Research Areas for VRK3 Antibody (NBP2-58572)

Find related products by research area.

Blogs on VRK3

There are no specific blogs for VRK3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our VRK3 Antibody and receive a gift card or discount.


Gene Symbol VRK3