Recombinant Human GIN-1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human GIN-1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-222 of Human GIN1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MVRSGKNGDLHLKQIAYYKRTCEYHSTTLPSERSGIRRAAKKFVFKEKKLFYVGKDRKQNRLVIVSEEEKKKVLRECHENDSGAHHGISRTLTLVESNYYWTSVTNDVKQWVYACQHCQVAKNTVIVAPKQHLLKVENPWSLVTVDLMGPFHTSNRSHVYAIIMTDLFTKWIVILPLCDVSASEVSKAIINIFFLYGPPQKIIMDQRDEFIQQKVFISCKVQ

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
GIN1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GIN-1 Protein

  • GIN-1gypsy integrase 1
  • gypsy retrotransposon integrase 1
  • TGIN1gypsy retrotransposon integrase-like protein 1
  • Ty3/Gypsy integrase 1
  • ZH2C2
  • Zinc finger H2C2 domain-containing protein
  • zinc finger, H2C2 domain containing

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00347527-B01P
Species: Hu
Applications: WB, ELISA
MAB38461
Species: Hu
Applications: WB, IHC
NBP2-30446
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87066
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81853
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1310
Species: Hu
Applications: WB, IHC, IP
NB600-930
Species: Hu, Ba
Applications: WB, ELISA
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
AF6144
Species: Hu
Applications: WB, Simple Western
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89703
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-80846
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14416
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00054826-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for GIN-1 Recombinant Protein (H00054826-P01) (0)

There are no publications for GIN-1 Recombinant Protein (H00054826-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GIN-1 Recombinant Protein (H00054826-P01) (0)

There are no reviews for GIN-1 Recombinant Protein (H00054826-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GIN-1 Recombinant Protein (H00054826-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GIN-1 Products

Bioinformatics Tool for GIN-1 Recombinant Protein (H00054826-P01)

Discover related pathways, diseases and genes to GIN-1 Recombinant Protein (H00054826-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GIN-1 Recombinant Protein (H00054826-P01)

Discover more about diseases related to GIN-1 Recombinant Protein (H00054826-P01).
 

Pathways for GIN-1 Recombinant Protein (H00054826-P01)

View related products by pathway.

PTMs for GIN-1 Recombinant Protein (H00054826-P01)

Learn more about PTMs related to GIN-1 Recombinant Protein (H00054826-P01).

Blogs on GIN-1

There are no specific blogs for GIN-1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

GIN-1 Antibody
NBP1-89856

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GIN-1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GIN1