C4.4A/LYPD3 Antibody

Images

 
Immunohistochemistry: LYPD3 Antibody [NBP2-32605] - Staining of human oral mucosa shows strong cytoplasmic and membranous positivity in squamous epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

C4.4A/LYPD3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: YFSPRIPPLVRLPPPEPTTVASTTSVTTSTSAPVRPTSTTKPMPAPTSQTPRQGVEHEASRDEEPRLTGGAAGHQDRSNSGQYP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
LYPD3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
C4.4A/LYPD3 Protein (NBP2-32605PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for C4.4A/LYPD3 Antibody

  • C4.4A
  • C4.4A2310061G07Rik
  • GPI-anchored metastasis-associated protein C4.4A homolog
  • GPI-anchored metastasis-associated protein homolog
  • LY6/PLAUR domain containing 3
  • ly6/PLAUR domain-containing protein 3
  • LYPD3
  • Matrigel-induced gene C4 protein
  • MIG-C4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-538
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-15307
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-14868
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83549
Species: Hu
Applications: ICC/IF, IHC, IHC-P
930-ADB
Species: Hu
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-24557
Species: Hu, Eq, Pm
Applications: WB, IHC-P
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80633
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1310
Species: Hu
Applications: WB, IHC, IP
NB600-1182
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-14835
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-48309
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
H00007103-M02
Species: Hu
Applications: WB, ELISA, ICC/IF

Publications for C4.4A/LYPD3 Antibody (NBP2-32605) (0)

There are no publications for C4.4A/LYPD3 Antibody (NBP2-32605).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C4.4A/LYPD3 Antibody (NBP2-32605) (0)

There are no reviews for C4.4A/LYPD3 Antibody (NBP2-32605). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for C4.4A/LYPD3 Antibody (NBP2-32605) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional C4.4A/LYPD3 Products

Bioinformatics Tool for C4.4A/LYPD3 Antibody (NBP2-32605)

Discover related pathways, diseases and genes to C4.4A/LYPD3 Antibody (NBP2-32605). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for C4.4A/LYPD3 Antibody (NBP2-32605)

Discover more about diseases related to C4.4A/LYPD3 Antibody (NBP2-32605).
 

Pathways for C4.4A/LYPD3 Antibody (NBP2-32605)

View related products by pathway.

PTMs for C4.4A/LYPD3 Antibody (NBP2-32605)

Learn more about PTMs related to C4.4A/LYPD3 Antibody (NBP2-32605).

Blogs on C4.4A/LYPD3

There are no specific blogs for C4.4A/LYPD3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our C4.4A/LYPD3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol LYPD3
Entrez