C4.4A/LYPD3 Antibody - BSA Free

Immunohistochemistry-Paraffin: C4.4A/LYPD3 Antibody [NBP2-32598] - Staining of human liver.

Immunohistochemistry: C4.4A/LYPD3 Antibody [NBP2-32598] - Staining of human oral mucosa shows strong cytoplasmic and membranous positivity in squamous epithelial cells.

Immunohistochemistry-Paraffin: C4.4A/LYPD3 Antibody [NBP2-32598] - Staining of human esophagus shows high expression.

Immunohistochemistry-Paraffin: C4.4A/LYPD3 Antibody [NBP2-32598] - Staining of human skeletal muscle shows low expression as expected.

Immunohistochemistry-Paraffin: C4.4A/LYPD3 Antibody [NBP2-32598] - Staining in human esophagus and skeletal muscle tissues using anti-LYPD3 antibody. Corresponding LYPD3 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: C4.4A/LYPD3 Antibody [NBP2-32598] - Staining of human colon, kidney, liver and skin using Anti-LYPD3 antibody NBP2-32598 (A) shows similar protein distribution across tissues to independent antibody NBP2-32605 (B).

Immunohistochemistry-Paraffin: C4.4A/LYPD3 Antibody [NBP2-32598] - Staining of human kidney.

Immunohistochemistry-Paraffin: C4.4A/LYPD3 Antibody [NBP2-32598] - Staining of human skin.

Immunohistochemistry-Paraffin: C4.4A/LYPD3 Antibody [NBP2-32598] - Staining of human colon.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

C4.4A/LYPD3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit C4.4A/LYPD3 Antibody - BSA Free (NBP2-32598) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: DGCSPNKMKTVKCAPGVDVCTEAVGAVETIHGQFSLAVRGCGSGLPGKNDRGLDLHGLLAFIQLQQCAQDRCNAKLNLTSRALDPAGN
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: LYPD3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  C4.4A/LYPD3 Protein (NBP2-32598PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (89%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for C4.4A/LYPD3 Antibody - BSA Free

• C4.4A
• C4.4A2310061G07Rik
• GPI-anchored metastasis-associated protein C4.4A homolog
• GPI-anchored metastasis-associated protein homolog
• LY6/PLAUR domain containing 3
• ly6/PLAUR domain-containing protein 3
• LYPD3
• Matrigel-induced gene C4 protein
• MIG-C4

Background

Supports cell migration. May be involved in urothelial cell-matrix interactions. May be involved in tumor progression

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: LYPD3