C4 binding protein B Antibody

Images

 
Immunohistochemistry-Paraffin: C4 binding protein B Antibody [NBP2-14412] - Staining of human nasopharynx shows strong cytoplasmic positivity in respiratory epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

C4 binding protein B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ILGTYVCIKGYHLVGKKTLFCNASKEWDNTTTECRLGHCPDPVLVNGEFS SSGPVNVSDKITFMCNDHYILKGSNR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C4BPB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
C4 binding protein B Protein (NBP2-14412PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for C4 binding protein B Antibody

  • C4b binding protein, beta chain
  • C4b-binding protein beta chain
  • C4BP
  • complement component 4 binding protein, beta chain
  • complement component 4 binding protein, beta
  • complement component 4-binding protein, beta

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-541
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
AF4779
Species: Hu
Applications: WB, IHC
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-34234
Species: Hu
Applications: ICC/IF, IHC-Fr, IHC-P
NBP1-88263
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-07799
Species: Hu
NBP2-29460
Species: Hu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PAGE
AF1936
Species: Hu
Applications: WB, IP
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB2005
Species: Hu
Applications: WB, Flow, CyTOF-ready
AF2009
Species: Hu
Applications: WB, IHC
AF2558
Species: Hu, Mu
Applications: WB, Simple Western
MAB3307
Species: Hu
Applications: WB, IP
H00000712-P01
Species: Hu
AF4885
Species: Mu
Applications: WB, IP
NBP2-14412
Species: Hu
Applications: IHC, IHC-P

Publications for C4 binding protein B Antibody (NBP2-14412) (0)

There are no publications for C4 binding protein B Antibody (NBP2-14412).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C4 binding protein B Antibody (NBP2-14412) (0)

There are no reviews for C4 binding protein B Antibody (NBP2-14412). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for C4 binding protein B Antibody (NBP2-14412) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional C4 binding protein B Products

Bioinformatics Tool for C4 binding protein B Antibody (NBP2-14412)

Discover related pathways, diseases and genes to C4 binding protein B Antibody (NBP2-14412). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for C4 binding protein B Antibody (NBP2-14412)

Discover more about diseases related to C4 binding protein B Antibody (NBP2-14412).
 

Pathways for C4 binding protein B Antibody (NBP2-14412)

View related products by pathway.

PTMs for C4 binding protein B Antibody (NBP2-14412)

Learn more about PTMs related to C4 binding protein B Antibody (NBP2-14412).

Blogs on C4 binding protein B

There are no specific blogs for C4 binding protein B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our C4 binding protein B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C4BPB