C4 binding protein A Antibody

Images

 
Western Blot: C4 binding protein A Antibody [H00000722-B01P] - Analysis of C4BPA expression in transfected 293T cell line by C4BPA polyclonal antibody. Lane 1: C4BPA transfected lysate(65.67 KDa). Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

C4 binding protein A Antibody Summary

Immunogen
C4BPA (NP_000706.1, 1 a.a. - 597 a.a.) full-length human protein. MHPPKTPSGALHRKRKMAAWPFSRLWKVSDPILFQMTLIAALLPAVLGNCGPPPTLSFAAPMDITLTETRFKTGTTLKYTCLPGYVRSHSTQTLTCNSDGEWVYNTFCIYKRCRHPGELRNGQVEIKTDLSFGSQIEFSCSEGFFLIGSTTSRCEVQDRGVGWSHPLPQCEIVKCKPPPDIRNGRHSGEENFYAYGFSVTYSCDPRFSLLGHASISCTVENETIGVWRPSPPTCEKITCRKPDVSHGEMVSGFGPIYNYKDTIVFKCQKGFVLRGSSVIHCDADSKWNPSPPACEPNSCINLPDIPHASWETYPRPTKEDVYVVGTVLRYRCHPGYKPTTDEPTTVICQKNLRWTPYQGCEALCCPEPKLNNGEITQHRKSRPANHCVYFYGDEISFSCHETSRFSAICQGDGTWSPRTPSCGDICNFPPKIAHGHYKQSSSYSFFKEEIIYECDKGYILVGQAKLSCSYSHWSAPAPQCKALCRKPELVNGRLSVDKDQYVEPENVTIQCDSGYGVVGPQSITCSGNRTWYPEVPKCEWETPEGCEQVLTGKRLMQCLPNPEDVKMALEVYKLSLEIEQLELQRDSARQSTLDKEL
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
C4BPA
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB and Functional.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for C4 binding protein A Antibody

  • C4b binding protein, alpha chain
  • C4b-binding protein alpha chain
  • C4BP
  • complement component 4 binding protein, alpha chain
  • complement component 4 binding protein, alpha
  • complement component 4-binding protein, alpha
  • Proline-rich protein
  • PRP

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56605
Species: Av, Bv, Sh
Applications: WB
NBP2-31928
Species: Hu
Applications: IHC, IHC-P
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
AF4779
Species: Hu
Applications: WB, IHC
NB200-541
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP2-07799
Species: Hu
NBP2-03351
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP2-24557
Species: Hu, Eq, Pm
Applications: WB, IHC-P
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB600-586
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-57614
Species: Hu
Applications: ICC/IF
H00000722-B01P
Species: Hu
Applications: WB

Publications for C4 binding protein A Antibody (H00000722-B01P) (0)

There are no publications for C4 binding protein A Antibody (H00000722-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C4 binding protein A Antibody (H00000722-B01P) (0)

There are no reviews for C4 binding protein A Antibody (H00000722-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for C4 binding protein A Antibody (H00000722-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional C4 binding protein A Products

Bioinformatics Tool for C4 binding protein A Antibody (H00000722-B01P)

Discover related pathways, diseases and genes to C4 binding protein A Antibody (H00000722-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for C4 binding protein A Antibody (H00000722-B01P)

Discover more about diseases related to C4 binding protein A Antibody (H00000722-B01P).
 

Pathways for C4 binding protein A Antibody (H00000722-B01P)

View related products by pathway.

PTMs for C4 binding protein A Antibody (H00000722-B01P)

Learn more about PTMs related to C4 binding protein A Antibody (H00000722-B01P).
 

Research Areas for C4 binding protein A Antibody (H00000722-B01P)

Find related products by research area.

Blogs on C4 binding protein A

There are no specific blogs for C4 binding protein A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our C4 binding protein A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C4BPA
Uniprot