C1qTNF10/C1qL2 Antibody

Images

 
Western Blot: C1qTNF10/C1qL2 Antibody [NBP2-84549] - Host: Rabbit. Target Name: C1QL2. Sample Type: Fetal Heart lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

C1qTNF10/C1qL2 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Human C1qTNF10/C1qL2. Peptide sequence: GTASGVGVVGGGAGVGGDSEGEVTSALSATFSGPKIAFYVGLKSPHEGYE The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
C1QL2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for C1qTNF10/C1qL2 Antibody

  • C1q and tumor necrosis factor related protein 10
  • C1q-domain containing protein
  • C1qL2
  • C1qTNF10
  • complement C1q-like protein 2
  • complement component 1, q subcomponent-like 2
  • CTRP10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-76626
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IF, IHC, IHC-P, WB
NBP1-87492
Species: Hu
Applications: IHC, IHC-P, WB
DRP300
Species: Hu
Applications: ELISA
9134-TN
Species: Hu
Applications: BA
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
MAB3167
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, WB
H00005706-M02
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, KD, WB
NBP2-46834
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-61118
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
H00010561-P01
Species: Hu
Applications: ELISA, AP, PA, WB
DHP250
Species: Hu
Applications: ELISA
AF1356
Species: Hu, Mu
Applications: CyTOF-ready, Flow, IHC, Simple Western, WB
MAB1846
Species: Hu, Mu, Rt
Applications: ICC, KO, WB
DLP00
Species: Hu
Applications: ELISA
DSE100
Species: Hu
Applications: ELISA
MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
H00001392-M02
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
NBP1-47839
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB

Publications for C1qTNF10/C1qL2 Antibody (NBP2-84549) (0)

There are no publications for C1qTNF10/C1qL2 Antibody (NBP2-84549).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C1qTNF10/C1qL2 Antibody (NBP2-84549) (0)

There are no reviews for C1qTNF10/C1qL2 Antibody (NBP2-84549). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for C1qTNF10/C1qL2 Antibody (NBP2-84549) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional C1qTNF10/C1qL2 Products

Bioinformatics Tool for C1qTNF10/C1qL2 Antibody (NBP2-84549)

Discover related pathways, diseases and genes to C1qTNF10/C1qL2 Antibody (NBP2-84549). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for C1qTNF10/C1qL2 Antibody (NBP2-84549)

Discover more about diseases related to C1qTNF10/C1qL2 Antibody (NBP2-84549).

Blogs on C1qTNF10/C1qL2

There are no specific blogs for C1qTNF10/C1qL2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our C1qTNF10/C1qL2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C1QL2