C1QB Antibody

Images

 
Western Blot: C1QB Antibody [H00000713-D01P] - Analysis of C1QB expression in mouse stomach.
Western Blot: C1QB Antibody [H00000713-D01P] - Analysis of C1QB expression in HeLa.
Western Blot: C1QB Antibody [H00000713-D01P] - Analysis of C1QB expression in human kidney.
Western Blot: C1QB Antibody [H00000713-D01P] - Analysis of C1QB expression in human pancreas.
Western Blot: C1QB Antibody [H00000713-D01P] - Analysis of C1QB expression in transfected 293T cell line by C1QB polyclonal antibody.Lane 1: C1QB transfected lysate(26.70 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

C1QB Antibody Summary

Immunogen
C1QB (NP_000482.3, 1 a.a. - 253 a.a.) full-length human protein. MMMKIPWGSIPVLMLLLLLGLIDISQAQLSCTGPPAIPGIPGIPGTPGPDGQPGTPGIKGEKGLPGLAGDHGEFGEKGDPGIPGNPGKVGPKGPMGPKGGPGAPGAPGPKGESGDYKATQKIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPRSGKFTCKVPGLYYFTYHASSRGNLCVNLMRGRERAQKVVTFCDYAYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPDMEA
Specificity
Reacts with complement component 1, q subcomponent, B chain.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C1QB
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This antibody is reactive against tissue and transfected lysate in WB and as a detection antibody in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for C1QB Antibody

  • B chain
  • complement C1q subcomponent subunit B
  • complement component 1, q subcomponent, B chain
  • complement subcomponent C1q chain B
  • q subcomponent, beta polypeptide

Background

This gene encodes a major constituent of the human complement subcomponent C1q. C1q associates with C1r and C1s in order to yield the first component of the serum complement system. Deficiency of C1q has been associated with lupus erythematosus and glomerulonephritis. C1q is composed of 18 polypeptide chains: six A-chains, six B-chains, and six C-chains. Each chain contains a collagen-like region located near the N terminus and a C-terminal globular region. The A-, B-, and C-chains are arranged in the order A-C-B on chromosome 1. This gene encodes the B-chain polypeptide of human complement subcomponent C1q [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB200-539
Species: Mu
Applications: Func, IA, ICC/IF, IHC, IHC-Fr
NBP2-30024
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P
AF1936
Species: Hu
Applications: WB, IP
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34234
Species: Hu
Applications: ICC/IF, IHC-Fr, IHC-P
H00000712-P01
Species: Hu
NB100-77417
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
NB600-637
Species: Hu, Mu, Rt, Ge
Applications: WB, ELISA, IHC, IHC-P
NB100-314
Species: Hu
Applications: WB, IP, PLA
NBP2-01625
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF5430
Species: Mu
Applications: WB, IP
NBP2-14892
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-32972
Species: Hu, Mu, Rt, Ch, Pm, Sh
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
H00000713-D01P
Species: Hu, Mu
Applications: WB

Publications for C1QB Antibody (H00000713-D01P) (0)

There are no publications for C1QB Antibody (H00000713-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C1QB Antibody (H00000713-D01P) (0)

There are no reviews for C1QB Antibody (H00000713-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for C1QB Antibody (H00000713-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional C1QB Products

Bioinformatics Tool for C1QB Antibody (H00000713-D01P)

Discover related pathways, diseases and genes to C1QB Antibody (H00000713-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for C1QB Antibody (H00000713-D01P)

Discover more about diseases related to C1QB Antibody (H00000713-D01P).
 

Pathways for C1QB Antibody (H00000713-D01P)

View related products by pathway.

PTMs for C1QB Antibody (H00000713-D01P)

Learn more about PTMs related to C1QB Antibody (H00000713-D01P).

Blogs on C1QB

There are no specific blogs for C1QB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our C1QB Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C1QB
Entrez
Uniprot