C1QB Antibody

Western Blot: C1QB Antibody [H00000713-B01P] - Analysis of C1QB expression in human pancreas.

Western Blot: C1QB Antibody [H00000713-B01P] - Analysis of C1QB expression in transfected 293T cell line by C1QB polyclonal antibody. Lane 1: C1QB transfected lysate(27.94 KDa). Lane 2: Non-transfected lysate.

Product Discontinued

C1QB Antibody Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: C1QB (AAH08983, 1 a.a. - 253 a.a.) full-length human protein. MMMKIPWGSIPVLMLLLLLGLIDISQAQLSCTGPPAIPGIPGIPGTPGPDGQPGTPGIKGEKGLPGLAGDHGEFGEKGDPGIPGNPGKVGPKGPMGPKGGPGAPGAPGPKGESGDYKATQKIAFSATRTINVPLRRDQTIRFDHVITNMNNNYEPRSGKFTCKVPGLYYFTYHASSRGNLCVNLMRGRERAQKVVTFCDYAYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPDMEA
• Specificity: C1QB - complement component 1, q subcomponent, B chain,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: C1QB
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for C1QB Antibody

• B chain
• complement C1q subcomponent subunit B
• complement component 1, q subcomponent, B chain
• complement subcomponent C1q chain B
• q subcomponent, beta polypeptide

Background

This gene encodes a major constituent of the human complement subcomponent C1q. C1q associates with C1r and C1s in order to yield the first component of the serum complement system. Deficiency of C1q has been associated with lupus erythematosus and glomerulonephritis. C1q is composed of 18 polypeptide chains: six A-chains, six B-chains, and six C-chains. Each chain contains a collagen-like region located near the N terminus and a C-terminal globular region. The A-, B-, and C-chains are arranged in the order A-C-B on chromosome 1. This gene encodes the B-chain polypeptide of human complement subcomponent C1q [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: C1QB
• Entrez:
  • 713(Human)
• Uniprot:
  • AAH08983.1(Human)