C1GALT1 Antibody

Images

 
Independent Antibodies: Immunohistochemistry-Paraffin: C1GALT1 Antibody [NBP1-88477] - Staining of human cerebral cortex, kidney, liver and parathyroid gland using Anti-C1GALT1 antibody NBP1-88477 (A) shows ...read more
Orthogonal Strategies: Western Blot: C1GALT1 Antibody [NBP1-88477] - Analysis in human cell lines U2OS and HEK293 using anti-C1GALT1 antibody. Corresponding C1GALT1 RNA-seq data are presented for the same cell ...read more
Immunohistochemistry-Paraffin: C1GALT1 Antibody [NBP1-88477] - Staining of human placenta shows strong cytoplasmic positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: C1GALT1 Antibody [NBP1-88477] - Staining of human cerebral cortex shows strong positivity in neuropil.
Immunohistochemistry-Paraffin: C1GALT1 Antibody [NBP1-88477] - Staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: C1GALT1 Antibody [NBP1-88477] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: C1GALT1 Antibody [NBP1-88477] - Staining of human parathyroid gland shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

C1GALT1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VDTQPNVLHNDPHARHSDDNGQNHLEGQMNFNADSSQHKDENTDIAENLYQKVRILCWVMTGPQNLEKKAKHVKATWAQRCNKVLFMSSEENKDFPAVGLKTKEGRDQLYWKTIK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C1GALT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
C1GALT1 Protein (NBP1-88477PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for C1GALT1 Antibody

  • B3Gal-T8
  • Beta-1,3-galactosyltransferase
  • C1GALT
  • C1GalT1
  • Core 1 beta1,3-galactosyltransferase 1
  • Core 1 Beta3-Gal-T1
  • Core 1 O-Glycan T-Synthase
  • core 1 synthase, glycoprotein-N-acetylgalactosamine3-beta-galactosyltransferase, 1
  • Core 1 UDP-galactose:N-acetylgalactosamine-alpha-R beta1,3-galactosyltransferase 1
  • EC 2.4.1.122
  • glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1
  • T-synthase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-17811
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-61794
Species: Hu, Pm, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NB120-22711
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
8334-GT
Species: Hu
Applications: EnzAct
NBP1-59769
Species: Hu
Applications: WB
AF1197
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NB120-11197
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
DCP00
Species: Hu
Applications: ELISA
AF7248
Species: Hu
Applications: ICC, IHC, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP1-81838
Species: Hu, Mu
Applications: IHC, IHC-P, WB
AF4160
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut, WB
AF3244
Species: Mu
Applications: IHC, WB
NBP1-88477
Species: Hu
Applications: WB, IHC, IHC-P

Publications for C1GALT1 Antibody (NBP1-88477) (0)

There are no publications for C1GALT1 Antibody (NBP1-88477).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for C1GALT1 Antibody (NBP1-88477) (0)

There are no reviews for C1GALT1 Antibody (NBP1-88477). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for C1GALT1 Antibody (NBP1-88477) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional C1GALT1 Products

Bioinformatics Tool for C1GALT1 Antibody (NBP1-88477)

Discover related pathways, diseases and genes to C1GALT1 Antibody (NBP1-88477). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for C1GALT1 Antibody (NBP1-88477)

Discover more about diseases related to C1GALT1 Antibody (NBP1-88477).
 

Pathways for C1GALT1 Antibody (NBP1-88477)

View related products by pathway.

PTMs for C1GALT1 Antibody (NBP1-88477)

Learn more about PTMs related to C1GALT1 Antibody (NBP1-88477).

Blogs on C1GALT1

There are no specific blogs for C1GALT1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our C1GALT1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C1GALT1