c-jun Antibody


Immunocytochemistry/ Immunofluorescence: Jun Antibody [NBP2-56932] - Staining of human cell line U-2 OS shows localization to nucleoplasm.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF

Order Details

c-jun Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: METTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKPHLRAKNSDLLT
Specificity of human Jun antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (95%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Jun Recombinant Protein Antigen (NBP2-56932PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for c-jun Antibody

  • Activator protein 1
  • AP1
  • AP-1
  • cJun
  • c-Jun
  • enhancer-binding protein AP1
  • Jun activation domain binding protein
  • jun oncogene
  • jun proto-oncogene
  • JUN
  • Proto-oncogene c-Jun
  • transcription factor AP-1
  • V-jun avian sarcoma virus 17 oncogene homologp39
  • v-jun sarcoma virus 17 oncogene homolog (avian)
  • v-jun sarcoma virus 17 oncogene homolog


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, KO
Species: Hu, Mu, Rt
Applications: WB, ICC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
Species: Hu, Rt, Rb
Applications: WB, Flow, IHC, IHC-P, KO
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu, Mu, Rt, Ze
Applications: WB, IHC, IHC-P, Flow-IC
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, S-ELISA
Species: Hu, Mu, Rt
Applications: WB, PEP-ELISA
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for Jun Antibody (NBP2-56932) (0)

There are no publications for Jun Antibody (NBP2-56932).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Jun Antibody (NBP2-56932) (0)

There are no reviews for Jun Antibody (NBP2-56932). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Jun Antibody (NBP2-56932) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional c-jun Products

Bioinformatics Tool for Jun Antibody (NBP2-56932)

Discover related pathways, diseases and genes to Jun Antibody (NBP2-56932). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Jun Antibody (NBP2-56932)

Discover more about diseases related to Jun Antibody (NBP2-56932).

Pathways for Jun Antibody (NBP2-56932)

View related products by pathway.

PTMs for Jun Antibody (NBP2-56932)

Learn more about PTMs related to Jun Antibody (NBP2-56932).

Research Areas for Jun Antibody (NBP2-56932)

Find related products by research area.

Blogs on c-jun.

  Read full blog post.

Estrogen Related Receptors Play Roles in Cancer and Neurodegeneration
By Eric NeeleyEstrogen receptors come in the form of two distinct forms, ER alpha and ER beta. These nuclear receptors are predominantly activated by the hormone 17-beta-estradiol to control transcription of genes throughout the immune, nervous, car...  Read full blog post.

Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our c-jun Antibody and receive a gift card or discount.


Gene Symbol JUN