Recombinant Human Bub1 GST (N-Term) Protein

SDS-Page: Recombinant Human Bub1 Protein [H00000699-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

• Reactivity: Hu
• Applications: WB, ELISA, IHC, MA, AP

Recombinant Human Bub1 GST (N-Term) Protein Summary

• Description: A recombinant protein with a N-terminal GST tagcorresponding to the amino acids 1-130 of Human BUB1
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: MDTPENVLQMLEAHMQSYKGNDPLGEWERYIQWVEENFPENKEYLITLLEHLMKEFLDKKKYHNDPRFISYCLKFAEYNSDLHQFFEFLYNHGIGTLSSPLYIAWAGHLEAQGELQHASAVLQRGIQNQA

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Recombinant Protein
• Gene: BUB1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Immunohistochemistry
  • Protein Array
  • Western Blot

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Bub1 GST (N-Term) Protein

• BUB1 budding uninhibited by benzimidazoles 1 homolog
• Bub1
• BUB1Amitotic checkpoint serine/threonine-protein kinase BUB1
• BUB1L
• budding uninhibited by benzimidazoles 1 (yeast homolog)
• budding uninhibited by benzimidazoles 1 homolog (yeast)
• EC 2.7.11.1
• hBUB1mitotic spindle checkpoint kinase
• putative serine/threonine-protein kinase

Background

BUB1 - BUB1 budding uninhibited by benzimidazoles 1 homolog (yeast)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Publications for Bub1 Partial Recombinant Protein (H00000699-Q01)(1)

Publication using H00000699-Q01

• Piche J, Gosset N, Legault L et al. Molecular signature of CAID syndrome: non-canonical roles of SGO1 in regulation of TGF-B signalling and epigenomics Sensors and Actuators B: Chemical 2019-01-01 [PMID: 30739867] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: BUB1