BTN2A1 Antibody - BSA Free

Western Blot: BTN2A1 Antibody [NBP1-62371] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.

Western Blot: BTN2A1 Antibody [NBP1-62371] - Human Thymus lysate, concentration 0.2-1 ug/ml.

Western Blot: BTN2A1 Antibody [NBP1-62371] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.

Western Blot: BTN2A1 Antibody [NBP1-62371] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

BTN2A1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to BTN2A1(butyrophilin, subfamily 2, member A1) The peptide sequence was selected from the N terminal of BTN2A1. Peptide sequence SVALVIHNITAQENGTYRCYFQEGRSYDEAILHLVVAGLGSKPLISMRGH. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BTN2A1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 57 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for BTN2A1 Antibody - BSA Free

• BK14H9.1
• BT2.1
• BTF1
• BTF1BT2.1butyrophilin BTF1
• BTN2A1
• butyrophilin subfamily 2 member A1
• butyrophilin, subfamily 2, member A1
• DJ3E1.1
• FLJ36567

Background

The specific functin of this protein remains unknown.This gene is a member of the BTN2 subfamily of genes, which encode proteins belonging to the butyrophilin protein family. The gene is located in a cluster on chromosome 6, consisting of seven genes belonging to the expanding B7/butyrophilin-like group, a subset of the immunoglobulin gene superfamily. The encoded protein is an integral plasma membrane B box protein involved in lipid, fatty-acid and sterol metabolism.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BTN2A1
• Uniprot:
  • Q7KYR7()