BTK Antibody

Images

 
Western Blot: BTK Antibody [NBP1-89207] - Analysis in human cell line HELA.
Immunocytochemistry/ Immunofluorescence: BTK Antibody [NBP1-89207] - Immunofluorescent staining of human cell line U-251 MG shows localization to vesicles.
Immunohistochemistry-Paraffin: BTK Antibody [NBP1-89207] - Staining of human lymph node shows strong cytoplasmic positivity in lymphoid cells outside reaction center.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BTK Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PAAAPVSTSELKKVVALYDYMPMNANDLQLRKGDEYFILEESNLPWWRARDKNGQEGYIPSNYVTEAEDSIEMYEWYSKHMTRSQAEQLLKQEGKEGGFIVRDSSKAGKYTVSVFAKSTGDPQGVIRHYVVCSTPQSQYYLAEKHL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BTK
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
  • Immunofluorescence 1-4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
BTK Protein (NBP1-89207PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BTK Antibody

  • Agammaglobulinaemia tyrosine kinase
  • AGMX1
  • AGMX1MGC126262
  • AT
  • ATKIMD1
  • B-cell progenitor kinase
  • BPK
  • Bruton agammaglobulinemia tyrosine kinase
  • Bruton tyrosine kinase
  • BTK
  • dominant-negative kinase-deficient Brutons tyrosine kinase
  • EC 2.7.10
  • EC 2.7.10.2
  • IMD1
  • PSCTK1
  • tyrosine-protein kinase BTK
  • XLA
  • XLAMGC126261

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-19097
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, PLA
NBP1-32945
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-37585
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB500-519
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP
NBP2-37578
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46403
Species: Hu
Applications: IHC
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA

Publications for BTK Antibody (NBP1-89207) (0)

There are no publications for BTK Antibody (NBP1-89207).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BTK Antibody (NBP1-89207) (0)

There are no reviews for BTK Antibody (NBP1-89207). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for BTK Antibody (NBP1-89207) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BTK Products

Bioinformatics Tool for BTK Antibody (NBP1-89207)

Discover related pathways, diseases and genes to BTK Antibody (NBP1-89207). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BTK Antibody (NBP1-89207)

Discover more about diseases related to BTK Antibody (NBP1-89207).
 

Pathways for BTK Antibody (NBP1-89207)

View related products by pathway.

PTMs for BTK Antibody (NBP1-89207)

Learn more about PTMs related to BTK Antibody (NBP1-89207).
 

Research Areas for BTK Antibody (NBP1-89207)

Find related products by research area.

Blogs on BTK.

CD79b - A Signal Transduction Component of the B-cell Receptor
The B-cell antigen receptor (BCR) is a complex multimeric aggregate that includes the following key noncovalently-bound components: antigen-specific surface immunoglobulin (Ig), CD79a (Ig-alpha), and CD79b (Ig-beta). BCR signaling is a pivotal pathway...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BTK Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BTK
Entrez