BTK Antibody - BSA Free

Immunohistochemistry-Paraffin: BTK Antibody [NBP1-89207] - Analysis in human tonsil and kidney tissues. Corresponding BTK RNA-seq data are presented for the same tissues.

Western Blot: BTK Antibody [NBP1-89207] - Analysis using Anti-BTK antibody NBP1-89207 (A) shows similar pattern to independent antibody NBP1-89206 (B).

Immunocytochemistry/Immunofluorescence: BTK Antibody [NBP1-89207] - Staining of human cell line U-251 MG shows localization to vesicles. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: BTK Antibody [NBP1-89207] - Staining of human lymph node shows strong membranous positivity in non-germinal center cells.

Immunohistochemistry-Paraffin: BTK Antibody [NBP1-89207] - Staining of human kidney shows no positivity in cells in tubules as expected.

Immunohistochemistry-Paraffin: BTK Antibody [NBP1-89207] - Staining of human liver shows no positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: BTK Antibody [NBP1-89207] - Staining of human tonsil shows strong membranous positivity in non-germinal center cells.

• Reactivity: Hu, Rt, Mu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

BTK Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PAAAPVSTSELKKVVALYDYMPMNANDLQLRKGDEYFILEESNLPWWRARDKNGQEGYIPSNYVTEAEDSIEMYEWYSKHMTRSQAEQLLKQEGKEGGFIVRDSSKAGKYTVSVFAKSTGDPQGVIRHYVVCSTPQSQYYLAEKHL
• Predicted Species: Mouse (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BTK
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  BTK Protein (NBP1-89207PEP)

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 30747048).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for BTK Antibody - BSA Free

• Agammaglobulinaemia tyrosine kinase
• AGMX1
• AGMX1MGC126262
• AT
• ATKIMD1
• B-cell progenitor kinase
• BPK
• Bruton agammaglobulinemia tyrosine kinase
• Bruton tyrosine kinase
• BTK
• dominant-negative kinase-deficient Brutons tyrosine kinase
• EC 2.7.10
• EC 2.7.10.2
• IMD1
• PSCTK1
• tyrosine-protein kinase BTK
• XLA
• XLAMGC126261

Background

Brutons tyrosine kinase (BTK) is a member of the BTK/Tec family of cytoplasmic tyrosine kinases. All members of the BTK/Tec family contain SH3 and SH2 domains and, with the exception of Txk and Dsrc28C, also contain a pleckstrin homology (PH) and a Tec homology (TH) domain in their amino termini. BTK plays an important role in B cell development. Activation of B cells by various ligands is accompanied by BTK membrane translocation mediated by its PH domain binding to phosphatidylinositol-3,4,5-trisphosphate. The membrane located BTK is active and associated with transient phosphorylation of two tyrosine residues, Tyr551 and Tyr223. Tyr551 in the activation loop is transphosphorylated by the Src family tyrosine kinase, leading to autophosphorylation at Tyr223 within the SH3 domain, which is necessary for full activation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for BTK Antibody (NBP1-89207)(1)

Publication using NBP1-89207

• Yu CG, Bondada V, Ghoshal S et al. Repositioning Flubendazole for Spinal Cord Injury J. Neurotrauma 2019-02-12 [PMID: 30747048] (WB, Rat)

Bioinformatics

• Gene Symbol: BTK