| Reactivity | Hu, Rt, MuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit BTK Antibody - BSA Free (NBP1-89207) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-BTK Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: PAAAPVSTSELKKVVALYDYMPMNANDLQLRKGDEYFILEESNLPWWRARDKNGQEGYIPSNYVTEAEDSIEMYEWYSKHMTRSQAEQLLKQEGKEGGFIVRDSSKAGKYTVSVFAKSTGDPQGVIRHYVVCSTPQSQYYLAEKHL |
| Predicted Species | Mouse (96%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | BTK |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-89207 | Applications | Species |
|---|---|---|
| Yu CG, Bondada V, Ghoshal S et al. Repositioning Flubendazole for Spinal Cord Injury J. Neurotrauma 2019-02-12 [PMID: 30747048] (WB, Rat) | WB | Rat |
Secondary Antibodies |
Isotype Controls |
Research Areas for BTK Antibody (NBP1-89207)Find related products by research area.
|
|
Repurposing FDA-approved drugs to combat the rise of antibiotic resistance By Beth Melson, MSAntibiotic resistance is a global threat to public health. Widespread, inappropriate use of antibiotics, such as to treat viral infections or promote growth in livestock, has led to increased incid... Read full blog post. |
|
CD79b - A Signal Transduction Component of the B-cell Receptor The B-cell antigen receptor (BCR) is a complex multimeric aggregate that includes the following key noncovalently-bound components: antigen-specific surface immunoglobulin (Ig), CD79a (Ig-alpha), and CD79b (Ig-beta). BCR signaling is a pivotal pathway... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | BTK |