New pricing — Effective July 1, 2022 -

Amidst rising costs across all areas of our business, and aggressive attempts to implement cost savings without sacrificing quality, we announce the need to implement a cost increase starting July 1, 2022. If you have questions, please contact your sales representative.

BTG2 Antibody (1B8)

Images

 
Western Blot: BTG2 Antibody (1B8) [H00007832-M02] - Analysis of BTG2 expression in transfected 293T cell line by BTG2 monoclonal antibody (M02), clone 1B8.Lane 1: BTG2 transfected lysate(17.4 KDa).Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1B8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

BTG2 Antibody (1B8) Summary

Immunogen
BTG2 (NP_006754, 59 a.a. ~ 158 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PSKGSGYRCIRINHKMDPIISRVASQIGLSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICVLYEEAPLAASCGLLTCKNQVLLGRSSPSKNYVMAVSS
Localization
Nuclear
Specificity
BTG2 - BTG family, member 2
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
BTG2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for BTG2 Antibody (1B8)

  • B-cell translocation gene 2
  • BTG family member 2
  • BTG family, member 2
  • MGC126063
  • MGC126064
  • NGF-inducible proliferative protein PC3
  • PC3nerve growth factor-inducible proliferative
  • pheochromacytoma cell-3
  • protein BTG2
  • TIS21

Background

The protein encoded by this gene is a member of the BTG/Tob family. This family has structurally related proteins that appear to have antiproliferative properties. This encoded protein is involved in the regulation of the G1/S transition of the cell cycle.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
AF6018
Species: Hu, Mu
Applications: ICC, IP, WB
NBP2-38536
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-52432
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
NBP2-14924
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-06363
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
H00005122-M02
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
DKK300
Species: Hu
Applications: ELISA
NBP2-27561
Species: Ch, Hu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
AF231
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
236-EG
Species: Hu
Applications: BA
DY262
Species: Hu
Applications: ELISA
NBP2-38530
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-89146
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56708
Species: Ch, ChHa, Hu, Ma, Mu, Po, Rt
Applications: CyTOF-ready, EM, Flow, HEStain, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, KD, KO, Simple Western, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB

Publications for BTG2 Antibody (H00007832-M02) (0)

There are no publications for BTG2 Antibody (H00007832-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BTG2 Antibody (H00007832-M02) (0)

There are no reviews for BTG2 Antibody (H00007832-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BTG2 Antibody (H00007832-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BTG2 Products

Bioinformatics Tool for BTG2 Antibody (H00007832-M02)

Discover related pathways, diseases and genes to BTG2 Antibody (H00007832-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BTG2 Antibody (H00007832-M02)

Discover more about diseases related to BTG2 Antibody (H00007832-M02).
 

Pathways for BTG2 Antibody (H00007832-M02)

View related products by pathway.

PTMs for BTG2 Antibody (H00007832-M02)

Learn more about PTMs related to BTG2 Antibody (H00007832-M02).
 

Research Areas for BTG2 Antibody (H00007832-M02)

Find related products by research area.

Blogs on BTG2

There are no specific blogs for BTG2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BTG2 Antibody (1B8) and receive a gift card or discount.

Bioinformatics

Gene Symbol BTG2
Entrez
OMIM
Uniprot