New pricing — Effective July 1, 2022 -

Amidst rising costs across all areas of our business, and aggressive attempts to implement cost savings without sacrificing quality, we announce the need to implement a cost increase starting July 1, 2022. If you have questions, please contact your sales representative.

Home » BTG2 » BTG2 Antibodies » BTG2 Antibody (1B8)

BTG2 Antibody (1B8)

 Submit a Review

Images

 
(
Enlarge)
Western Blot: BTG2 Antibody (1B8) [H00007832-M02] - Analysis of BTG2 expression in transfected 293T cell line by BTG2 monoclonal antibody (M02), clone 1B8.Lane 1: BTG2 transfected lysate(17.4 KDa).Lane 2: Non-transfected lysate.
Western Blot: BTG2 Antibody (1B8) [H00007832-M02] - Analysis of BTG2 expression in transfected 293T cell line by BTG2 monoclonal antibody (M02), clone 1B8.Lane 1: BTG2 transfected lysate(17.4 KDa).Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1B8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

BTG2 Antibody (1B8) Summary

Immunogen
BTG2 (NP_006754, 59 a.a. ~ 158 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PSKGSGYRCIRINHKMDPIISRVASQIGLSQPQLHQLLPSELTLWVDPYEVSYRIGEDGSICVLYEEAPLAASCGLLTCKNQVLLGRSSPSKNYVMAVSS
Localization
Nuclear
Specificity
BTG2 - BTG family, member 2
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
BTG2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for BTG2 Antibody (1B8)

  • B-cell translocation gene 2
  • BTG family member 2
  • BTG family, member 2
  • MGC126063
  • MGC126064
  • NGF-inducible proliferative protein PC3
  • PC3nerve growth factor-inducible proliferative
  • pheochromacytoma cell-3
  • protein BTG2
  • TIS21

Background

The protein encoded by this gene is a member of the BTG/Tob family. This family has structurally related proteins that appear to have antiproliferative properties. This encoded protein is involved in the regulation of the G1/S transition of the cell cycle.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Androgen R/NR3C4
[p Ser213, p Ser210] ...
NB100-56603
Western Blot: Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) [NB100-56603] - Analysis using Azide Free version of NB100-56603. LNCaP cells (passage number 38) were serum-starved for 2 days. After serum starvation, cells were (A) left untreated, (B) treated with 100 ng/ml IGF-1 for 4h, or (C) incubated with 20 um LY294002 for 30 mi
(14 Publications)
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Proprotein
Convertase 2/PCSK2 An
AF6018
Western blot shows lysates of MCF‑7 human breast cancer cell line, beta TC‑6 mouse beta cell insulinoma cell line, and HepG2 human hepatocellular carcinoma cell line. PVDF Membrane was probed with 1 µg/mL of Sheep Anti-Human Proprotein Convertase 2/PCSK2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6018) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Proprotein Convertase 2/PCSK2 at approximately 70 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Proprotein Convertase 2/PCSK2 was detected in immersion fixed HepG2 human hepatocellular carcinoma cell line using Sheep Anti-Human/Mouse Proprotein Convertase 2/PCSK2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6018) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Sheep IgG Secondary Antibody (red; Catalog # NL010) and counterstained with DAPI (blue).This application has not been tested in mouse samples. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(1 Publication)
Species: Hu, Mu
Applications: ICC, IP, WB
Cytokeratin 17
Antibody
NBP2-38536
Immunohistochemistry-Paraffin: Cytokeratin 17 Antibody [NBP2-38536] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: Cytokeratin 17 Antibody [NBP2-38536] - Staining of human urinary bladder shows high expression.
Immunocytochemistry/Immunofluorescence: Cytokeratin 17 Antibody [NBP2-38536] - Staining of human cell line hTCEpi shows localization to intermediate filaments. Antibody staining is shown in green.
(1 Review)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
CBX4 Antibody
(6C5G3) - BSA Free
NBP2-52432
ELISA: CBX4 Antibody (6C5G3) [NBP2-52432] - Black line: Control Antigen (100 ng); Purple line: Antigen(10ng); Blue line: Antigen (50 ng); Red line: Antigen (100 ng).
Flow Cytometry: CBX4 Antibody (6C5G3) [NBP2-52432] - Flow cytometric analysis of Hela cells using CBX4 mouse mAb (green) and negative control (red).
Immunohistochemistry-Paraffin: CBX4 Antibody (6C5G3) [NBP2-52432] - Analysis of cervical cancer tissues using CBX4 mouse mAb with DAB staining.
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
Cytokeratin 6b
Antibody
NBP2-14924
Immunocytochemistry/Immunofluorescence: Cytokeratin 6b Antibody [NBP2-14924] - Analysis of methanol-fixed HeLa, using antibody at 1:500 dilution.
Immunohistochemistry-Paraffin: Cytokeratin 6b Antibody [NBP2-14924] - Paraffin-embedded mouse brain, using antibody at 1:500 dilution.
Western Blot: Cytokeratin 6b Antibody [NBP2-14924] - Sample (1 ug of whole cell lysate) A: HeLa 7. 5% SDS PAGE; antibody diluted at 1:5000.
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Polycystin 2
Antibody
NBP3-06363
Western Blot: Polycystin 2 Antibody [NBP3-06363] - Anti-PKD2 rabbit polyclonal antibody at 1:500 dilutionLane A: HeLa Whole Cell LysateLane B: HEK293 Whole Cell LysateLane C: NIH3T3 Whole Cell LysateLysates/proteins at 30 ug per lane.SecondaryGoat Anti-Rabbit IgG (H+L) HRP at 110000 dilution.Developed using the ECL technique.Performed under reducing conditions.Predicted band size: 97 kDa
Immunoprecipitation: Polycystin 2 Antibody [NBP3-06363] - PKD2 was immunoprecipitated using:Lane A:0.5 mg HeLa Whole Cell Lysate4 uL anti-PKD2 rabbit polyclonal antibody and 60 ug of Immunomagnetic beads Protein AG. Primary antibody:Anti-PKD2 rabbit polyclonal antibody, at 1:100 dilution Secondary antibody:Goat Anti-Rabbit IgG (H+L) HRP at 110000 dilutionDeveloped using the ECL technique.Performed under reducing conditions.Predicted band size: 97 kDaObserved band size: 80 kDa
Immunocytochemistry/Immunofluorescence: Polycystin 2 Antibody [NBP3-06363] - Immunofluorescence staining of PKD2 in HeLa cells. Cells were fixed with 4% PFA, permeabilzed with 0.1% Triton X-100 in PBS,blocked with 10% serum, and incubated with rabbit anti-Human PKD2 polyclonal antibody (dilution ratio 1:200) at 4 degrees celsius overnight. Then cells were stained with the Alexa Fluor (TM) 488-conjugated Goat Anti-rabbit IgG secondary antibody (green) and counterstained with DAPI (blue).Positive staining was localized to Cytoplasm.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Proprotein
Convertase 1/PCSK1 An ...
H00005122-M02
Immunocytochemistry/Immunofluorescence: Proprotein Convertase 1/PCSK1 Antibody (3D2) [H00005122-M02] - Analysis of monoclonal antibody to PCSK1 on HeLa cell. Antibody concentration 30 ug/ml.
Immunohistochemistry-Paraffin: Proprotein Convertase 1/PCSK1 Antibody (3D2) [H00005122-M02] - Analysis of monoclonal antibody to PCSK1 on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration 3 ug/ml.
Sandwich ELISA: Proprotein Convertase 1/PCSK1 Antibody (3D2) [H00005122-M02] - Detection limit for recombinant GST tagged PCSK1 is approximately 0.03ng/ml as a capture antibody.
(1 Publication)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
p53 Antibody (PAb
240) - BSA Free
NB200-103
Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
Flow Cytometry: p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on A549 cells with p53 (PAb240) NB200-103AF488 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.
Flow (Intracellular): p53 Antibody (PAb 240) [NB200-103] - An intracellular stain was performed on HeLa cells with p53 (PAb240) NB200-103 (blue) and a matched isotype control NBP2-27287 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature, followed by APC-conjugated anti-mouse IgG secondary antibody F0101B.
(3 Reviews)
(33 Publications)
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin: p21/CIP1/CDKN1A Antibody (WA-1) [NBP2-29463] - Formalin-fixed, paraffin-embedded human bladder carcinoma stained with p21 Monoclonal Antibody (WA-1).
(15 Publications)
Species: Pm, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Kallikrein 3/PSA
[HRP]
DKK300
(1 Review)
(16 Publications)
Species: Hu
Applications: ELISA
ENPP-1 Antibody
NBP2-27561
Immunohistochemistry-Paraffin: ENPP-1 Antibody [NBP2-27561] - Staining of paraffin embedded Human Thyroid Gland at dilution of 8ug/ml. Heat induced antigen retrieval with citrate buffer pH 6, HRP-staining.
Immunohistochemistry-Paraffin: ENPP-1 Antibody [NBP2-27561] - Negative Control showing staining of paraffin embedded Human Thyroid Gland, with no primary antibody.
(7 Publications)
Species: Ch, Hu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
AKT [p Ser473]
Antibody - Pan Specif
AF887
Western blot shows lysates of NIH‑3T3 mouse embryonic fibroblast cell line untreated (-) or treated (+) with 100 ng/mL Human PDGF (Catalog # 120‑HD) for 15 minutes and MCF‑7 human breast cancer cell line untreated or treated with 100 ng/mL Recombinant Human IGF-1 (Catalog # 291‑G1) for 15 minutes. PVDF membrane was probed with 0.5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Akt (S473) Pan Specific at approximately 60 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of MCF‑7 human breast cancer cell line and A549 human lung carcinoma cell line untreated (-) or treated (+) with 100 ng/mL Recombinant Human IGF‑I (Catalog # 291-G1) for 15 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Akt (S473) at approximately 60 kDa (as indicated) using 5 µg/mL of Rabbit Anti-Human/Mouse/Rat Phospho-Akt (S473) Pan Specific Antigen Affinity-purified Polyclonal Antibody (Catalog # AF887). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Serum-starved MCF‑7 human breast cancer cells were unstimulated (light orange filled histogram) or activated with 100 ng/mL Recombinant human IGF-1 (Catalog # 291-G1, dark orange filled histogram) for 15 minutes, then stained with Rabbit Anti-Human/Mouse/Rat Phospho‑Akt (S473) Antigen Affinity‑purified Polyclonal Antibody (Catalog # AF887) or control antibody (Catalog # AB-105-C, open histogram), followed by Allophycocyanin-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # F0111). To facilitate intracellular staining, cells were fixed with paraformaldehyde and permeabilized with saponin.
(26 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
EGFR Antibody
[Unconjugated]
AF231
EGFR was detected in immersion fixed frozen sections of human skin using Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231) at 1 µg/mL for 1 hour at room temperature followed by incubation with the Anti-Goat IgG VisUCyte™ HRP Polymer Antibody (Catalog # VC004). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue). Specific staining was localized to plasma membrane. View our protocol for IHC Staining with VisUCyte HRP Polymer Detection Reagents.
EGFR was detected in immersion fixed A431 human epithelial carcinoma cell line using Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231) at 1 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to plasma membrane. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line and MDA‑MB‑231 human breast cancer cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human EGFR Antigen Affinity-purified Polyclonal Antibody (Catalog # AF231) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for EGFR at approximately 175 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(1 Review)
(13 Publications)
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
EGF [Unconjugated]
236-EG
1 µg/lane of Recombinant Human EGF was resolved with SDS-PAGE  and visualized by silver staining under reducing (R) conditions, showing a single band at 6 kDa.
Recombinant Human EGF (Catalog # 236‑EG) stimulates cell proliferation of the Balb/3T3 mouse embryonic fibroblast cell line. The ED50 for this effect is 20‑100 pg/mL.
(27 Reviews)
(588 Publications)
Species: Hu
Applications: BA
Amphiregulin
[Biotin]
DY262
(1 Review)
(38 Publications)
Species: Hu
Applications: ELISA
Ferredoxin
Reductase Antibody
NBP2-38530
Western Blot: Ferredoxin Reductase Antibody [NBP2-38530] - Analysis in human cell lines A-549 and U-251MG using anti-FDXR antibody. Corresponding FDXR RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.
Western Blot: Ferredoxin Reductase Antibody [NBP2-38530] - Analysis using Anti-FDXR antibody NBP2-38530 (A) shows similar pattern to independent antibody NBP2-38706 (B).
Immunohistochemistry-Paraffin: Ferredoxin Reductase Antibody [NBP2-38530] - Staining of human adrenal gland shows strong granular cytoplasmic positivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AKR1B1 Antibody
NBP1-89146
Immunohistochemistry-Paraffin: AKR1B1 Antibody [NBP1-89146] - Staining of human cerebral cortex shows low expression as expected.
Immunohistochemistry-Paraffin: AKR1B1 Antibody [NBP1-89146] - Staining in human adrenal gland and cerebral cortex tissues using anti-AKR1B1 antibody. Corresponding AKR1B1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: AKR1B1 Antibody [NBP1-89146] - Analysis in human adrenal gland and liver tissues. Corresponding AKR1B1 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Caspase-3 Antibody
(31A1067) - (Pro and ...
NB100-56708
Flow Cytometry: Caspase-3 Antibody (31A1067) - (Pro and Active) [NB100-56708] - An intracellular stain was performed on HeLa cells with Caspase-3 Antibody (31A1067) - (Pro and Active) NB100-56708 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature, followed by mouse F(ab)2 IgG (H+L) APC-conjugated secondary antibody (F0101B, R&D Systems).
Flow Cytometry: Caspase-3 Antibody (31A1067) - (Pro and Active) [NB100-56708] - An intracellular stain was performed on NIH3T3 cells with Caspase-3 Antibody (31A1067) - (Pro and Active) Antibody NB100-56708AF700 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 700.
Western Blot: Caspase-3 Antibody (31A1067) - (Pro and Active) [NB100-56708] - Paclitaxel in combination with MWE retarded tumor growth in a human bladder carcinoma TSGH 8301 xenograft model. The levels of total (t-PTEN) and phospho-PTEN (p-PTEN) and Caspase 3 in the tumor specimens were determined by Western blotting and then quantified using beta-actin as the protein loading control; the results are expressed as a percentage of the control. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/srep20417), licensed under a CC-BY licence.
(2 Reviews)
(167 Publications)
Species: Ch, ChHa, Hu, Ma, Mu, Po, Rt
Applications: CyTOF-ready, EM, Flow, HEStain, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, KD, KO, Simple Western, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Insulin was detected in immersion fixed beta TC‑6 mouse beta cell insulinoma cell line using Human/Mouse/Bovine Insulin Monoclonal Antibody (Catalog # MAB1417) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rat IgG Secondary Antibody (red; Catalog # NL013) and counterstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(14 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Bcl-2 Antibody
NB100-56098
Western Blot: Bcl-2 Antibody [NB100-56098] - EA reduced MPP+-induced dopaminergic neuronal apoptosis by increasing BDNF (brain-derived neurotrophic factor) expression and further Akt phosphorylation in the rat substantia nigra. Eight days after MPP+ administration, our Western blot results (MAB7566) show that MPP+ treatment reduced tyrosine hydroxylase and Bcl-2 expression in the ipsilateral side of the rat substantia nigra (SN), but not in the contralateral side. EA stimulation (50 Hz) enhanced mature BDNF, tyrosine hydroxylase, and Bcl-2 expression in the MPP+-treated ipsilateral side. Image collected and cropped by CiteAb from the following publication (http://www.mdpi.com/1422-0067/18/9/1846), licensed under a CC-BY licence.
Western Blot: Bcl-2 Antibody [NB100-56098] - Analysis of Bcl-2 in whole cell lysate from Daoy cells. Cells were transfected with (1) scrambled control siRNA or (2) Bcl-2 siRNA. Image from verified customer review.
Western Blot: Bcl-2 Antibody [NB100-56098] - Analysis of Bcl-2 using this antibody at 1:2000, 20 ug/protein was loaded per lane. (1) Human Jurkat T cells. (2) Human RS11 lymphoma cells. (3-6) Human breast cancer cases. Patient sample in lane 5 lacked detectible Bcl-2 expression.
(2 Reviews)
(14 Publications)
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB

Publications for BTG2 Antibody (H00007832-M02) (0)

There are no publications for BTG2 Antibody (H00007832-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BTG2 Antibody (H00007832-M02) (0)

There are no reviews for BTG2 Antibody (H00007832-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BTG2 Antibody (H00007832-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BTG2 Products

Bioinformatics Tool for BTG2 Antibody (H00007832-M02)

Discover related pathways, diseases and genes to BTG2 Antibody (H00007832-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BTG2 Antibody (H00007832-M02)

Discover more about diseases related to BTG2 Antibody (H00007832-M02).
 

Pathways for BTG2 Antibody (H00007832-M02)

View related products by pathway.

PTMs for BTG2 Antibody (H00007832-M02)

Learn more about PTMs related to BTG2 Antibody (H00007832-M02).
 

Research Areas for BTG2 Antibody (H00007832-M02)

Find related products by research area.

Blogs on BTG2

There are no specific blogs for BTG2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BTG2 Antibody (1B8) and receive a gift card or discount.


Bioinformatics

Gene Symbol BTG2
Entrez
OMIM
Uniprot