BTBD9 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: BTBD9 Antibody [NBP1-84228] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: BTBD9 Antibody [NBP1-84228] - Staining of human fallopian tube shows strong nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BTBD9 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:ILDAIKVRSESRDMDLNYRGMLIPEENIATMKYGAQVVKGELKSALLDGDTQNYDLDHGFSRHPIDDDCRSGIEIKLGQPSIINHIRILLWDR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BTBD9
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
BTBD9 Protein (NBP1-84228PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BTBD9 Antibody

  • BTB (POZ) domain containing 9
  • BTB/POZ domain-containing protein 9
  • FLJ32945
  • KIAA1880dJ322I12.1
  • MGC120517
  • MGC120519
  • MGC120520

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24597
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, IHC-P
NBP2-49153
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB5764
Species: Hu
Applications: Flow, IHC, CyTOF-ready
H00023648-M01
Species: Hu
Applications: WB, ELISA
NBP1-84382
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90622
Species: Hu
Applications: IHC, IHC-P
NBP1-59576
Species: Hu
Applications: WB, IHC
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NB100-858
Species: Hu, Mu, Rt, GP, Mk
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA, IHC-WhMt
NBP1-85632
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF619
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NB100-1798
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-P, GS
NBP2-27084
Species: Hu, Pm
Applications: WB, IHC-P
NB110-60491
Species: Hu, Mu
Applications: WB, Simple Western, ELISA, Flow, IHC, IHC-Fr, IHC-P
NBP1-84228
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for BTBD9 Antibody (NBP1-84228) (0)

There are no publications for BTBD9 Antibody (NBP1-84228).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BTBD9 Antibody (NBP1-84228) (0)

There are no reviews for BTBD9 Antibody (NBP1-84228). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for BTBD9 Antibody (NBP1-84228) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BTBD9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BTBD9