BSPRY Antibody

Images

 
Western Blot: BSPRY Antibody [NBP1-82204] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunohistochemistry-Paraffin: BSPRY Antibody [NBP1-82204] - Staining of human uterus, pre-menopause shows moderate cytoplasmic and membranous positivity in glandular cells.
Western Blot: BSPRY Antibody [NBP1-82204] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BSPRY Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NSCAYKVGVASGHLPRKGSGSDCRLGHNAFSWVFSRYDQEFRFSHNGQHEPLGLLRGPAQLGVVLDLQVQELLFYEPASGTVLCAHHVSFPGPLFPVFAVADQTISIVR
Specificity
Specificity of human, mouse, rat BSPRY antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BSPRY
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Control Peptide
BSPRY Protein (NBP1-82204PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BSPRY Antibody

  • B box and SPRY domain-containing protein
  • B-box and SPRY domain containing
  • B-box and SPRY-domain containing protein
  • FLJ20150
  • zetin 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3628
Species: Mu, Rt
Applications: WB, Flow, IHC, CyTOF-ready, ICC
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB100-93520
Species: Hu
Applications: WB, ICC/IF, PEP-ELISA
NBP1-74138
Species: Hu, Rt
Applications: WB, ICC/IF, IHC
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, ICC, IHC-FrFl
NBP1-89727
Species: Hu
Applications: WB, IHC, IHC-P
MAB2669
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP2-66296
Species: Hu
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
AF-237-NA
Species: Hu
Applications: WB, IHC, Neut
NBP1-98474
Species: Hu
Applications: WB
NBP2-27202
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Fe, Op, Pm
Applications: WB, Simple Western
NBP2-19779
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB300-186
Species: Hu, Rt
Applications: WB, Simple Western, ICC/IF
NB110-41083
Species: Hu
Applications: WB, ChIP, ELISA
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-402
Species: Hu, Mu, Rt, Po, Xp, Ze
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-31310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-82204
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for BSPRY Antibody (NBP1-82204) (0)

There are no publications for BSPRY Antibody (NBP1-82204).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BSPRY Antibody (NBP1-82204) (0)

There are no reviews for BSPRY Antibody (NBP1-82204). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BSPRY Antibody (NBP1-82204) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for BSPRY Antibody (NBP1-82204)

Discover related pathways, diseases and genes to BSPRY Antibody (NBP1-82204). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BSPRY Antibody (NBP1-82204)

Discover more about diseases related to BSPRY Antibody (NBP1-82204).
 

Pathways for BSPRY Antibody (NBP1-82204)

View related products by pathway.

Blogs on BSPRY

There are no specific blogs for BSPRY, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BSPRY Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BSPRY