![Western Blot: BSPRY Antibody [H00054836-B01P] - Analysis of BSPRY expression in human pancreas.](http://images.novusbio.com/fullsize/BSPRY-Antibody-Western-Blot-H00054836-B01P-img0001.jpg "Western Blot: BSPRY Antibody [H00054836-B01P] - Analysis of BSPRY expression in human pancreas.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | BSPRY (AAH01477.1, 1 a.a. - 193 a.a.) full-length human protein. MSAEGAEPGPGSGSGPGPGPLCPEHGQALSWFCGSERRPVCAACAGLGGRCRGHRIRRAEERAEELRNKIVDQCERLQLQSAAITKYVADVLPGKNQRAVSMASAARELVIQRLSLVRSLCESEEQRLLEQVHGEEERAHQSILTQRVHWAEALQKLDTIRTGLVGMLTHLDDLQLIQKEQEIFERHRGHTDR |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Mouse |
| Gene | BSPRY |
| Purity | Protein G purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | This antibody is useful for Western Blot |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein G purified |
![Immunohistochemistry CD31/PECAM-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD31_AF3628_Immunohistochemistry_10287.jpg)
![Flow Cytometry CD31/PECAM-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD31_AF3628_Flow_Cytometry_16017.jpg)
![Immunohistochemistry CD31/PECAM-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD31_AF3628_Immunohistochemistry_21486.jpg)
![Immunohistochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunohistochemistry_20892.jpg)
![Immunocytochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunocytochemistry__Immunofluorescence_21143.jpg)
![Western Blot EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Western_Blot_19925.jpg)
| Publication using H00054836-B01P | Applications | Species |
|---|---|---|
| Giusti L, Cetani F, Ciregia F et al. A proteomic approach to study parathyroid glands. Mol Biosyst. 2010-12-21 [PMID: 21180715] |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | BSPRY |
| Uniprot |
|
![Western Blot: BSPRY Antibody [H00054836-B01P] - Analysis of BSPRY expression in transfected 293T cell line by BSPRY polyclonal antibody. Lane 1: BSPRY transfected lysate(21.23 KDa). Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/BSPRY-Antibody-Western-Blot-H00054836-B01P-img0002.jpg "Western Blot: BSPRY Antibody [H00054836-B01P] - Analysis of BSPRY expression in transfected 293T cell line by BSPRY polyclonal antibody. Lane 1: BSPRY transfected lysate(21.23 KDa). Lane 2: Non-transfected lysate.")
![Simple Western 14-3-3 zeta Antibody (818515) [Unconjugated]](https://images.novusbio.com/images2/1433_zeta_MAB2669_Simple_Western_16526.jpg)
![Western Blot 14-3-3 zeta Antibody (818515) [Unconjugated]](https://images.novusbio.com/images2/14-3-3_zeta_MAB2669_Western_Blot_12700.jpg)
![Immunohistochemistry 14-3-3 zeta Antibody (818515) [Unconjugated]](https://images.novusbio.com/images2/14-3-3_zeta_MAB2669_Immunohistochemistry_12730.jpg)
![LIF [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "LIF [Unconjugated]")
![Immunohistochemistry-Paraffin: Goat anti-Mouse IgG (H+L) Secondary Antibody [HRP] [NB7539] - FFPE serial sections of human stomach carcinoma. Primary Antibody: Mouse anti-p53 (Clone DO-1) used at a dilution of 1:100. Secondary Antibody: Goat anti-Mouse IgG (H+L) Secondary Antibody [HRP] Conjugated used at a dilution of 1:200 (5ug/ml). Detection: DAB](https://images.novusbio.com/images/Goat-anti-Mouse-IgG-H+L-Secondary-Antibody-HRP-Immunohistochemistry-Paraffin-NB7539-img0014.jpg "Immunohistochemistry-Paraffin: Goat anti-Mouse IgG (H+L) Secondary Antibody [HRP] [NB7539] - FFPE serial sections of human stomach carcinoma. Primary Antibody: Mouse anti-p53 (Clone DO-1) used at a dilution of 1:100. Secondary Antibody: Goat anti-Mouse IgG (H+L) Secondary Antibody [HRP] Conjugated used at a dilution of 1:200 (5ug/ml). Detection: DAB")
![Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]](https://images.novusbio.com/images/Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP1-97019-img0004.jpg "Flow Cytometry: Mouse IgG Isotype Control [NBP1-97019]")