Recombinant Human BRSK1 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human BRSK1 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 289-380 of Human BRSK1

Source: Wheat Germ

Amino Acid Sequence: KHEPDPCLEPAPGRRVAMRSLPSNGELDPDVLESMASLGCFRDRERLHRELRSEEENQEKMIYYLLLDRKERYPSCEDQDLPPRNDVDPPRK

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
BRSK1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
35.86 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human BRSK1 Protein

  • BR serine/threonine kinase 1
  • EC 2.7.11
  • EC 2.7.11.1
  • FLJ43009
  • KIAA1811BR serine/threonine-protein kinase 1
  • protein kinase SAD1A
  • SAD1 kinase
  • SAD1
  • Serine/threonine-protein kinase SAD-B

Background

BRSK1 - BR serine/threonine kinase 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77281
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P, IF
NBP2-14835
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF2850
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NB100-239
Species: Hu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
H00005564-M02
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NB100-56546
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NB100-308
Species: Hu, Mu
Applications: WB, Func, ICC/IF, IP
NBP1-33506
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-22527
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-292
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-49938
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
H00008846-B01P
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP1-33409
Species: Hu
Applications: WB, ICC/IF
NBP1-78028
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, ICC/IF
NBP2-46234
Species: Hu
Applications: WB, IHC
H00084446-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for BRSK1 Partial Recombinant Protein (H00084446-Q01) (0)

There are no publications for BRSK1 Partial Recombinant Protein (H00084446-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BRSK1 Partial Recombinant Protein (H00084446-Q01) (0)

There are no reviews for BRSK1 Partial Recombinant Protein (H00084446-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BRSK1 Partial Recombinant Protein (H00084446-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional BRSK1 Products

Bioinformatics Tool for BRSK1 Partial Recombinant Protein (H00084446-Q01)

Discover related pathways, diseases and genes to BRSK1 Partial Recombinant Protein (H00084446-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BRSK1 Partial Recombinant Protein (H00084446-Q01)

Discover more about diseases related to BRSK1 Partial Recombinant Protein (H00084446-Q01).
 

Pathways for BRSK1 Partial Recombinant Protein (H00084446-Q01)

View related products by pathway.

PTMs for BRSK1 Partial Recombinant Protein (H00084446-Q01)

Learn more about PTMs related to BRSK1 Partial Recombinant Protein (H00084446-Q01).

Blogs on BRSK1

There are no specific blogs for BRSK1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ATM Antibody
NB100-104
BRSK1 Antibody
NBP1-76778

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human BRSK1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol BRSK1