BROX Antibody

Images

 
Western Blot: BROX Antibody [NBP1-90706] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: BROX Antibody [NBP1-90706] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm, cytosol & the Golgi apparatus.
Immunohistochemistry-Paraffin: BROX Antibody [NBP1-90706] - Staining of human urinary bladder shows distinct nuclear and cytoplasmic positivity in urothelial cells.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BROX Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LGNLVKNTLEKCQRENGFIYFQKIPTEAPQLELKANYGLVEPIPFEFPPTSVQWTPETLAAFDLTKRPKDDSTKPKPEEEVKPVKEPDIKPQKDTGCYIS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
BROX
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:500-1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
BROX Protein (NBP1-90706PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for BROX Antibody

  • BRO1 domain and CAAX motif containing
  • BRO1 domain- and CAAX motif-containing protein
  • BRO1 domain-containing protein BROX
  • Bro1-domain-containing protein
  • BROFTI
  • C1orf58
  • FLJ32421
  • MGC142195
  • MGC142197
  • RP11-452F19.1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-49557
Species: Hu
Applications: IHC, IHC-P
NB100-65678
Species: Hu, Mu, Rt, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-91782
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84158
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-20881
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-112
Species: Hu, Mu, Rt, Ha, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KO
H00054504-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBL1-17720
Species: Hu
NBP2-01693
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-83967
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00008086-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
NBP1-82881
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-92308
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-83726
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-57242
Species: Hu
Applications: WB, ICC/IF
MAB1233
Species: Hu
Applications: Flow, IP, CyTOF-ready, ICC
NBP1-83107
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37485
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
NBP1-90706
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for BROX Antibody (NBP1-90706) (0)

There are no publications for BROX Antibody (NBP1-90706).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BROX Antibody (NBP1-90706) (0)

There are no reviews for BROX Antibody (NBP1-90706). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for BROX Antibody (NBP1-90706) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BROX Products

Bioinformatics Tool for BROX Antibody (NBP1-90706)

Discover related pathways, diseases and genes to BROX Antibody (NBP1-90706). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BROX Antibody (NBP1-90706)

Discover more about diseases related to BROX Antibody (NBP1-90706).
 

Pathways for BROX Antibody (NBP1-90706)

View related products by pathway.

PTMs for BROX Antibody (NBP1-90706)

Learn more about PTMs related to BROX Antibody (NBP1-90706).

Blogs on BROX

There are no specific blogs for BROX, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BROX Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BROX