BRDG1/STAP-1 Antibody (5A10)

Images

 
Western Blot: BRDG1/STAP-1 Antibody (5A10) [H00026228-M01] - Analysis of BRDG1 expression in transfected 293T cell line by BRDG1 monoclonal antibody (M01), clone 5A10.Lane 1: BRDG1 transfected lysate(34.3 KDa).Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
5A10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

BRDG1/STAP-1 Antibody (5A10) Summary

Immunogen
BRDG1 (NP_036240, 186 a.a. ~ 293 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EATEMLQKNPSLGNMILRPGSDSRNYSITIRQEIDIPRIKHYKVMSVGQNYTIELEKPVTLPNLFSVIDYFVKETRGNLRPFICSTDENTGQEPSMEGRSEKLKKNPH
Specificity
BRDG1 (5A10)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
STAP1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for ELISA.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for BRDG1/STAP-1 Antibody (5A10)

  • BCR downstream-signaling protein 1
  • BRDG1
  • BRDG1STAP-1BCR downstream signaling 1
  • Docking protein BRDG1
  • signal transducing adaptor family member 1
  • signal-transducing adaptor protein 1
  • signal-transducing adaptor protein-1
  • STAP1
  • Stem cell adaptor protein 1

Background

The protein encoded by this gene functions as a docking protein acting downstream of Tec tyrosine kinase in B cell antigen receptor signaling. The protein is directly phosphorylated by Tec in vitro where it participates in a postive feedback loop, increasing Tec activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2685
Species: Hu
Applications: IHC, Simple Western, WB
NB100-1343
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
NB300-987
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP2-48615
Species: Hu
Applications: IHC, IHC-P, WB
NB100-56104
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
NBP1-78295
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-67627
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF5129
Species: Hu
Applications: WB
NBP1-37000
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
AF3206
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
H00004068-M01
Species: Hu, Mu
Applications: ELISA, Flow, Func, WB
NBP2-37578
Species: Hu
Applications: ELISA, Flow, ICC/IF, WB
AF5414
Species: Hu
Applications: Simple Western, WB
AF5887
Species: Hu
Applications: IHC, WB
NBP1-43363
Species: Mu
Applications: B/N, Flow, IHC, IHC-Fr, IHC-P, WB
NBP1-32945
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
236-EG
Species: Hu
Applications: BA
AF2168
Species: Hu, Mu
Applications: ChIP, Simple Western, WB
NB600-302
Species: Bv, Dr, Hu, Mu
Applications: ChIP, ELISA, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, S-ELISA, Simple Western, WB
H00026228-M01
Species: Hu
Applications: WB, ELISA

Publications for BRDG1/STAP-1 Antibody (H00026228-M01) (0)

There are no publications for BRDG1/STAP-1 Antibody (H00026228-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BRDG1/STAP-1 Antibody (H00026228-M01) (0)

There are no reviews for BRDG1/STAP-1 Antibody (H00026228-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BRDG1/STAP-1 Antibody (H00026228-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BRDG1/STAP-1 Products

Bioinformatics Tool for BRDG1/STAP-1 Antibody (H00026228-M01)

Discover related pathways, diseases and genes to BRDG1/STAP-1 Antibody (H00026228-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BRDG1/STAP-1 Antibody (H00026228-M01)

Discover more about diseases related to BRDG1/STAP-1 Antibody (H00026228-M01).
 

Pathways for BRDG1/STAP-1 Antibody (H00026228-M01)

View related products by pathway.

PTMs for BRDG1/STAP-1 Antibody (H00026228-M01)

Learn more about PTMs related to BRDG1/STAP-1 Antibody (H00026228-M01).
 

Research Areas for BRDG1/STAP-1 Antibody (H00026228-M01)

Find related products by research area.

Blogs on BRDG1/STAP-1

There are no specific blogs for BRDG1/STAP-1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BRDG1/STAP-1 Antibody (5A10) and receive a gift card or discount.

Bioinformatics

Gene Symbol STAP1
Entrez
OMIM
Uniprot