BRD9 Antibody

Images

 
Western Blot: BRD9 Antibody [NBP2-87081] - Lanes: 1: 60ug mouse melanocytes (melba), 2: 60ug mouse melanoma (B16), 3: 60ug human melanocytes (HFSC), 4: 60ug human melanoma (SK-MEL5), 5: 60ug human melanoma (YUMAC), 6: ...read more
Western Blot: BRD9 Antibody [NBP2-87081] - WB Suggested Anti-BRD9 Antibody Titration: 2.5ug/ml. ELISA Titer: 1:62500. Positive Control: Jurkat cell lysateBRD9 is supported by BioGPS gene expression data to be expressed ...read more
Western Blot: BRD9 Antibody [NBP2-87081] - Host: Rabbit. Target: BRD9. Positive control (+): HeLa Cell Lysate (HL). Negative control (-): Human Kidney (KI). Antibody concentration: 2.5ug/ml

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, Gp, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

BRD9 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of human BRD9. Peptide sequence: VTEFKADFKLMCDNAMTYNRPDTVYYKLAKKILHAGFKMMSKQAALLGNE The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Rat (100%), Canine (100%), Equine (92%), Guinea Pig (100%), Bovine (100%), Rabbit (100%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
BRD9
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Alternate Names for BRD9 Antibody

  • BRD9
  • bromodomain containing 9
  • bromodomain-containing protein 9
  • DKFZp434D0711
  • DKFZp686L0539
  • FLJ13441
  • FLJ43530
  • LAVS3040
  • PRO9856
  • Rhabdomyosarcoma antigen MU-RMS-40.8
  • sarcoma antigen NY-SAR-29

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-43567
Species: Hu, Mu
Applications: WB, ICC/IF, KO
NBP1-88932
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-22164
Species: Mu, Rt, Hu(-)
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP1-84378
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-03349
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
H00057492-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-97500
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Ha, Pm, Rb, Sh, Ye
Applications: WB, IB, ICC/IF, IHC, IHC-P
NBP1-30941
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76512
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P, IF
NBP2-74883
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, CyTOF-ready
NBP2-48784
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-60661
Species: Hu
Applications: WB, IHC, IHC-Fr, IP
H00008815-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-34031
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF662
Species: Mu
Applications: WB, IHC
NBP1-57310
Species: Hu
Applications: WB, IHC, IHC-P
H00009275-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP2-15559
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19795
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for BRD9 Antibody (NBP2-87081) (0)

There are no publications for BRD9 Antibody (NBP2-87081).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BRD9 Antibody (NBP2-87081) (0)

There are no reviews for BRD9 Antibody (NBP2-87081). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BRD9 Antibody (NBP2-87081) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional BRD9 Products

Bioinformatics Tool for BRD9 Antibody (NBP2-87081)

Discover related pathways, diseases and genes to BRD9 Antibody (NBP2-87081). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BRD9 Antibody (NBP2-87081)

Discover more about diseases related to BRD9 Antibody (NBP2-87081).
 

Pathways for BRD9 Antibody (NBP2-87081)

View related products by pathway.

PTMs for BRD9 Antibody (NBP2-87081)

Learn more about PTMs related to BRD9 Antibody (NBP2-87081).

Blogs on BRD9

There are no specific blogs for BRD9, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BRD9 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BRD9