BRD7 Antibody - BSA Free

Western Blot: BRD7 Antibody [NBP2-92408] - Western blot analysis of extracts from normal (control) and BRD7 Rabbit pAb knockout (KO) 293T cells, using BRD7 Rabbit pAb antibody (NBP2-92408) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 180s.

Western Blot: BRD7 Antibody [NBP2-92408] - Analysis of extracts of various cell lines, using BRD7 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 60s.

• Reactivity: Hu
• Applications: WB, KO
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

BRD7 Antibody - BSA Free Summary

• Description: Novus Biologicals Knockout (KO) Validated Rabbit BRD7 Antibody - BSA Free (NBP2-92408) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-95 of human BRD7 (NP_037395.2). MGKKHKKHKSDKHLYEEYVEKPLKLVLKVGGNEVTELSTGSSGHDSSLFEDKNDHDKHKDRKRKKRKKGEKQIPGEEKGRKRRRVKEDKKKRDRD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BRD7
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Knockout Validated
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 74 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for BRD7 Antibody - BSA Free

• 75 kDa bromodomain protein
• BP75
• BP75bromodomain-containing 7
• BRD7
• bromodomain containing 7
• bromodomain-containing protein 7
• CELTIX1
• CELTIX1NAG4
• NAG4
• Protein CELTIX-1

Background

Bromodomain-containing protein 7 was identified in a two-hybrid screen as an interactor of interferon regulatory factor-2 (IRF-2) and called CELTIX1. BRD7 was also identified as a binding partner of disheveled-1 (Dvl-1) and found to play a role in Wnt signaling and the regulation of glycogen synthase kinase 3-beta activity. Recently, BRD7 was identified as a subunit of the polybromo-associated BRG1-associated factor (PBAF) complex and shown to be required for the modulation of transcription in embryonic stem cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BRD7