BRD7 Antibody - BSA Free

Western Blot: BRD7 Antibody [NBP2-87080] - WB Suggested Anti-BRD7 Antibody Titration: 0.2-1 ug/ml. Positive Control: Jurkat cell lysateBRD7 is supported by BioGPS gene expression data to be expressed in Jurkat

Immunohistochemistry-Paraffin: BRD7 Antibody [NBP2-87080] - Rabbit Anti-BRD7 antibody. Paraffin Embedded Tissue: Human Lung. Cellular Data: alveolar cell. Antibody Concentration: 4.0-8.0 ug/ml. Magnification: 400X

Western Blot: BRD7 Antibody [NBP2-87080] - Host: Rabbit. Target Name: BRD7. Sample Type: Jurkat. Lane A: Primary Antibody. Lane B: Primary Antibody + Blocking Peptide. Primary Antibody Concentration: 2.5ug/mL. Peptide Concentration: 2.0ug/mL. Lysate Quantity: 25ug/lane. Gel Concentration: 12%BRD7

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

BRD7 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit BRD7 Antibody - BSA Free (NBP2-87080) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human BRD7. Peptide sequence: KELAQQVTPGDIVSTYGVRKAMGISIPSPVMENNFVDLTEDTEEPKKTDV The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: BRD7
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for BRD7 Antibody - BSA Free

• 75 kDa bromodomain protein
• BP75
• BP75bromodomain-containing 7
• BRD7
• bromodomain containing 7
• bromodomain-containing protein 7
• CELTIX1
• CELTIX1NAG4
• NAG4
• Protein CELTIX-1

Background

Bromodomain-containing protein 7 was identified in a two-hybrid screen as an interactor of interferon regulatory factor-2 (IRF-2) and called CELTIX1. BRD7 was also identified as a binding partner of disheveled-1 (Dvl-1) and found to play a role in Wnt signaling and the regulation of glycogen synthase kinase 3-beta activity. Recently, BRD7 was identified as a subunit of the polybromo-associated BRG1-associated factor (PBAF) complex and shown to be required for the modulation of transcription in embryonic stem cells.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: BRD7