Home » BRD2 » BRD2 Antibodies » BRD2 Antibody (3D10)

BRD2 Antibody (3D10)

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: BRD2 Antibody (3D10) [H00006046-M01] - BRD2 monoclonal antibody (M01), clone 3D10. Analysis of BRD2 expression in Hela S3 NE.
Western Blot: BRD2 Antibody (3D10) [H00006046-M01] - BRD2 monoclonal antibody (M01), clone 3D10. Analysis of BRD2 expression in Hela S3 NE.
ELISA: BRD2 Antibody (3D10) [H00006046-M01] - Detection limit for recombinant GST tagged BRD2 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3D10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

BRD2 Antibody (3D10) Summary

Immunogen
BRD2 (NP_005095 167 a.a. - 256 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QTLEKIFLQKVASMPQEEQELVVTIPKNSHKKGAKLAALQGSVTSAHQVPAVSSVSHTALYTPPPEIPTTVLNIPHPSVISSPLLKSLHS
Specificity
BRD2 - bromodomain containing 2
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
BRD2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.
Publications
Read Publication using H00006046-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for BRD2 Antibody (3D10)

  • bromodomain containing 2
  • bromodomain-containing 2
  • bromodomain-containing protein 2
  • D6S113E
  • female sterile homeotic-related gene 1
  • FSRG1FSH
  • KIAA9001FLJ31942
  • NAT
  • O27.1.1
  • Really interesting new gene 3 protein
  • RING3DKFZp686N0336
  • RNF3

Background

This gene encodes a transcriptional regulator that belongs to the BET (bromodomains and extra terminal domain) family of proteins. This protein associates with transcription complexes and with acetylated chromatin during mitosis, and it selectively binds to the acetylated lysine-12 residue of histone H4 via its two bromodomains. The gene maps to the major histocompatability complex (MHC) class II region on chromosome 6p21.3, but sequence comparison suggests that the protein is not involved in the immune response. This gene has been implicated in juvenile myoclonic epilepsy, a common form of epilepsy that becomes apparent in adolescence. Multiple alternatively spliced variants have been described for this gene, but the full-length nature of some of these variants has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PLOD1 Antibody
NBP2-38770
Western Blot: PLOD1 Antibody [NBP2-38770] - Analysis using Anti-PLOD1 antibody NBP2-38770 (A) shows similar pattern to independent antibody NBP2-31885 (B).
Immunohistochemistry-Paraffin: PLOD1 Antibody [NBP2-38770] - Staining of human placenta shows cytoplasmic positivity in decidual cells.
(2 Publications)
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Prolactin Antibody
(OTI6B1)
NBP2-02142
Western Blot: Prolactin Antibody (6B1) [NBP2-02142] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Prolactin (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Prolactin.
Immunocytochemistry/Immunofluorescence: Prolactin Antibody (6B1) [NBP2-02142] Staining of COS7 cells transiently transfected by pCMV6-ENTRY Prolactin.
Immunohistochemistry-Paraffin: Prolactin Antibody (6B1) [NBP2-02142] - Staining of paraffin-embedded Human Ovary tissue using anti-Prolactin mouse monoclonal antibody.
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
PBX1 Antibody (4A2)
H00005087-M01
Western Blot: PBX1 Antibody (4A2) [H00005087-M01] - PBX1 monoclonal antibody (M01), clone 4A2 Analysis of PBX1 expression in Hela S3 NE.
Immunocytochemistry/Immunofluorescence: PBX1 Antibody (4A2) [H00005087-M01] - Analysis of monoclonal antibody to PBX1 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: PBX1 Antibody (4A2) [H00005087-M01] - Analysis of monoclonal antibody to PBX1 on formalin-fixed paraffin-embedded human salivary gland. Antibody concentration 3 ug/ml.
(8 Publications)
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
DBT Antibody
NBP1-89522
Western Blot: DBT Antibody [NBP1-89522] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/Immunofluorescence: DBT Antibody [NBP1-89522] - Staining of human cell line A-431 shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: DBT Antibody [NBP1-89522] - Staining of human colon.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
POMC Antibody
NB100-1533
Western Blot: POMC Antibody [NB100-1533] - Staining of NIH3T3 cell lysate (35 ug protein in RIPA buffer). Antibody at 0.3 ug/mL. Detected by chemiluminescence.
Immunohistochemistry-Paraffin: POMC Antibody [NB100-1533] - Staining of paraffin embedded Human Pituitary Gland. Antibody at 2 ug/mL. Steamed antigen retrieval with Tris/EDTA buffer pH 9, HRP-staining.
(8 Publications)
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Growth Hormone
Antibody [Unconjugate
AF1067
Western blot shows lysates of human, mouse, and rat pituitary gland tissue. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human Growth Hormone Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1067) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Growth Hormone at approximately 22 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Recombinant Human Growth Hormone protein was serially diluted 2-fold and captured by Mouse Anti-Human Growth Hormone Monoclonal Antibody (Catalog # MAB10671) coated on a Clear Polystyrene Microplate (Catalog # DY990). Goat Anti-Human/Mouse/Rat Growth Hormone Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1067) was biotinylated and incubated with the protein captured on the plate. Detection of the standard curve was achieved by incubating Streptavidin-HRP (Catalog # DY998) followed by Substrate Solution (Catalog # DY999) and stopping the enzymatic reaction with Stop Solution (Catalog # DY994).
Recombinant Human Growth Hormone (Catalog # 1067-GH) stimulates proliferation in the Nb2‑11 rat lymphoma cell line in a dose-dependent manner (orange line). Proliferation elicited by Recombinant Human Growth Hormone (0.2 ng/mL) is neutralized (green line) by increasing concentrations of Goat Anti-Human/Mouse/Rat Growth Hormone Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1067). The ND50 is typically 1.5-7.5 ng/mL.
(3 Reviews)
(6 Publications)
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
IGF-I/IGF-1
[Unconjugated]
291-G1
1 μg/lane of Recombinant Human IGF-I/IGF-1 was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 7 kDa.
Recombinant Human IGF-I/IGF-1 (Catalog # 291-G1) stimulates proliferation in the MCF-7 human breast cancer cell line. The ED50 for this effect is 0.3‑1.5 ng/mL.
MALDI-TOF analysis of Recombinant Human IGF-I/IGF-1.The major peak corresponds to the calculated molecular mass, 7650 Da. The minor peak at 7873 is a matrix-associated artifact of the MALDI-TOF.
(3 Reviews)
(111 Publications)
Species: Hu
Recombinant Human
gamma-glutamyl hydrol ...
NBP1-78898
SDS-Page: Recombinant Human gamma-glutamyl hydrolase Protein [NBP1-78898]
Species: Hu
GnRH Antibody
NB300-506
Immunohistochemistry-Paraffin: GnRH Antibody [NB300-506] - Immunolocalization of GnRH in mouse embryo brain.
Immunohistochemistry-Paraffin: GnRH Antibody [NB300-506] - Analysis of Hyla cinerea (green treefrog) forebrain using GnRH Polyclonal Antibody. Tissues were blocked in 10% normal goat serum in 0.1M PBS and then stained. Staining was developed with DAB substrate for 10 minutes. Data courtesy of Innovators Program.
(1 Publication)
Species: Mu, Am
Applications: ICC/IF, IHC, IHC-P
Insulin Antibody
(E2-E3 (same as INS04 ...
NBP2-34260
Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Insulin E2E3, human pancreas (FFPE), HIER pH 9 antigen retrieval. Image from verified customer review.
Immunohistochemistry-Paraffin: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260] - Formalin-fixed, paraffin-embedded human pancreas stained with insulin Monoclonal Antibody (E2-E3)
SDS-Page: Insulin Antibody (E2-E3 (same as INS04)) [NBP2-34260]
(5 Reviews)
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Thyrotropin
Releasing Hormone Ant
NBP2-34014
Immunohistochemistry-Paraffin: Thyrotropin Releasing Hormone Antibody [NBP2-34014] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: Thyrotropin Releasing Hormone Antibody [NBP2-34014] - Analysis in human cervix, uterine and skeletal muscle tissues. Corresponding TRH RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Thyrotropin Releasing Hormone Antibody [NBP2-34014] - Staining of human cervix, uterine shows moderate to strong cytoplasmic positivity in glandular cells.
Species: Hu
Applications: IHC, IHC-P
Aromatase Antibody
NB100-1596
Western Blot: Aromatase Antibody [NB100-1596] - Detection of aromatase in human fetal temporal lobe lysate using NB 100-1596. ECL exposure, 1-2 minutes.
Immunocytochemistry/Immunofluorescence: Aromatase Antibody [NB100-1596] - Aromatase antibody was tested in SH-SY-5Y cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).
(6 Publications)
Species: Hu, Rt, Pm, Rb
Applications: WB, Simple Western, ICC/IF, IHC
Growth Hormone
Antibody [Unconjugate
AF1067
Western blot shows lysates of human, mouse, and rat pituitary gland tissue. PVDF membrane was probed with 0.5 µg/mL of Goat Anti-Human Growth Hormone Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1067) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Growth Hormone at approximately 22 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Recombinant Human Growth Hormone protein was serially diluted 2-fold and captured by Mouse Anti-Human Growth Hormone Monoclonal Antibody (Catalog # MAB10671) coated on a Clear Polystyrene Microplate (Catalog # DY990). Goat Anti-Human/Mouse/Rat Growth Hormone Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1067) was biotinylated and incubated with the protein captured on the plate. Detection of the standard curve was achieved by incubating Streptavidin-HRP (Catalog # DY998) followed by Substrate Solution (Catalog # DY999) and stopping the enzymatic reaction with Stop Solution (Catalog # DY994).
Recombinant Human Growth Hormone (Catalog # 1067-GH) stimulates proliferation in the Nb2‑11 rat lymphoma cell line in a dose-dependent manner (orange line). Proliferation elicited by Recombinant Human Growth Hormone (0.2 ng/mL) is neutralized (green line) by increasing concentrations of Goat Anti-Human/Mouse/Rat Growth Hormone Antigen Affinity-purified Polyclonal Antibody (Catalog # AF1067). The ND50 is typically 1.5-7.5 ng/mL.
(3 Reviews)
(6 Publications)
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, Neut
EGF [Unconjugated]
236-EG
Recombinant Human EGF (Catalog # 236‑EG) stimulates cell proliferation of the Balb/3T3 mouse embryonic fibroblast cell line. The ED50 for this effect is 20‑100 pg/mL.
1 µg/lane of Recombinant Human EGF was resolved with SDS-PAGE  and visualized by silver staining under reducing (R) conditions, showing a single band at 6 kDa.
(11 Reviews)
(336 Publications)
Species: Hu
Chorionic
Gonadotropin alpha Ch ...
MAB4169
Chorionic Gonadotropin, alpha  Chain ( alpha  HCG) was detected in immersion fixed paraffin-embedded sections of human placenta using Mouse Anti-Human Chorionic Gonadotropin, alpha  Chain ( alpha  HCG) Monoclonal Antibody (Catalog # MAB4169) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Review)
Species: Hu
Applications: WB, IHC
ERMAP Antibody
AF4928
K562 human chronic myelogenous leukemia cell line was stained with Goat Anti-Human ERMAP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4928, filled histogram) or control antibody (Catalog # AB-108-C, open histogram), followed by Allophycocyanin-conjugated Anti-Goat IgG Secondary Antibody (Catalog # F0108).
Species: Hu
Applications: WB, Flow, CyTOF-ready
Recombinant Human
CGB5 Protein
H00093659-P01
12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
LIGHT/TNFSF14
[Unconjugated]
664-LI
1 µg/lane of Recombinant Human LIGHT/TNFSF14 (Catalog # 664-LI was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a band at 25 kDa.
Recombinant Human LIGHT/TNFSF14 (Catalog # 664-LI) stimulates cell proliferation in HUVEC human umbilical vein endothelial cells. The ED50 is 1-4 ng/mL.
(12 Publications)
Species: Hu

Publications for BRD2 Antibody (H00006046-M01)(1)


Reviews for BRD2 Antibody (H00006046-M01) (0)

There are no reviews for BRD2 Antibody (H00006046-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BRD2 Antibody (H00006046-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for BRD2 Antibody (H00006046-M01)

Discover related pathways, diseases and genes to BRD2 Antibody (H00006046-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BRD2 Antibody (H00006046-M01)

Discover more about diseases related to BRD2 Antibody (H00006046-M01).
 

Pathways for BRD2 Antibody (H00006046-M01)

View related products by pathway.

PTMs for BRD2 Antibody (H00006046-M01)

Learn more about PTMs related to BRD2 Antibody (H00006046-M01).
 

Research Areas for BRD2 Antibody (H00006046-M01)

Find related products by research area.

Blogs on BRD2

There are no specific blogs for BRD2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BRD2 Antibody (3D10) and receive a gift card or discount.


Bioinformatics

Gene Symbol BRD2
Entrez
OMIM
Uniprot