BRD2 Antibody (3D10)

Images

 
Western Blot: BRD2 Antibody (3D10) [H00006046-M01] - BRD2 monoclonal antibody (M01), clone 3D10. Analysis of BRD2 expression in Hela S3 NE.
Sandwich ELISA: BRD2 Antibody (3D10) [H00006046-M01] - Detection limit for recombinant GST tagged BRD2 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3D10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

BRD2 Antibody (3D10) Summary

Immunogen
BRD2 (NP_005095 167 a.a. - 256 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QTLEKIFLQKVASMPQEEQELVVTIPKNSHKKGAKLAALQGSVTSAHQVPAVSSVSHTALYTPPPEIPTTVLNIPHPSVISSPLLKSLHS
Specificity
BRD2 - bromodomain containing 2
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
BRD2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.
Publications
Read Publication using H00006046-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for BRD2 Antibody (3D10)

  • bromodomain containing 2
  • bromodomain-containing 2
  • bromodomain-containing protein 2
  • D6S113E
  • female sterile homeotic-related gene 1
  • FSRG1FSH
  • KIAA9001FLJ31942
  • NAT
  • O27.1.1
  • Really interesting new gene 3 protein
  • RING3DKFZp686N0336
  • RNF3

Background

This gene encodes a transcriptional regulator that belongs to the BET (bromodomains and extra terminal domain) family of proteins. This protein associates with transcription complexes and with acetylated chromatin during mitosis, and it selectively binds to the acetylated lysine-12 residue of histone H4 via its two bromodomains. The gene maps to the major histocompatability complex (MHC) class II region on chromosome 6p21.3, but sequence comparison suggests that the protein is not involved in the immune response. This gene has been implicated in juvenile myoclonic epilepsy, a common form of epilepsy that becomes apparent in adolescence. Multiple alternatively spliced variants have been described for this gene, but the full-length nature of some of these variants has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
H00005087-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45825
Species: Hu
Applications: WB, IHC
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-22444
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IF
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-34014
Species: Hu
Applications: IHC, IHC-P
NB100-1596
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
AF1067
Species: Hu, Mu, Rt
Applications: WB, IHC, Neut
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
H00093659-T01
Species: Hu
H00006046-M01
Species: Hu
Applications: WB, ELISA

Publications for BRD2 Antibody (H00006046-M01)(1)

Reviews for BRD2 Antibody (H00006046-M01) (0)

There are no reviews for BRD2 Antibody (H00006046-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BRD2 Antibody (H00006046-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BRD2 Products

Bioinformatics Tool for BRD2 Antibody (H00006046-M01)

Discover related pathways, diseases and genes to BRD2 Antibody (H00006046-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BRD2 Antibody (H00006046-M01)

Discover more about diseases related to BRD2 Antibody (H00006046-M01).
 

Pathways for BRD2 Antibody (H00006046-M01)

View related products by pathway.

PTMs for BRD2 Antibody (H00006046-M01)

Learn more about PTMs related to BRD2 Antibody (H00006046-M01).
 

Research Areas for BRD2 Antibody (H00006046-M01)

Find related products by research area.

Blogs on BRD2

There are no specific blogs for BRD2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BRD2 Antibody (3D10) and receive a gift card or discount.

Bioinformatics

Gene Symbol BRD2
Entrez
OMIM
Uniprot