Reactivity | HuSpecies Glossary |
Applications | WB, ELISA |
Clone | 3D10 |
Clonality | Monoclonal |
Host | Mouse |
Conjugate | Unconjugated |
Immunogen | BRD2 (NP_005095 167 a.a. - 256 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QTLEKIFLQKVASMPQEEQELVVTIPKNSHKKGAKLAALQGSVTSAHQVPAVSSVSHTALYTPPPEIPTTVLNIPHPSVISSPLLKSLHS |
Specificity | BRD2 - bromodomain containing 2 |
Isotype | IgG2b Kappa |
Clonality | Monoclonal |
Host | Mouse |
Gene | BRD2 |
Purity | IgG purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
|
Application Notes | Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA. |
|
Publications |
|
Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.4) |
Preservative | No Preservative |
Purity | IgG purified |
Publication using H00006046-M01 | Applications | Species |
---|---|---|
Lee YS, Lee JW, Jang JW et al. Runx3 inactivation is a crucial early event in the development of lung adenocarcinoma. Cancer Cell. 2013 Oct 02 [PMID: 24229708] |
Secondary Antibodies |
Isotype Controls |
Diseases for BRD2 Antibody (H00006046-M01)Discover more about diseases related to BRD2 Antibody (H00006046-M01).
| Pathways for BRD2 Antibody (H00006046-M01)View related products by pathway.
|
PTMs for BRD2 Antibody (H00006046-M01)Learn more about PTMs related to BRD2 Antibody (H00006046-M01).
| Research Areas for BRD2 Antibody (H00006046-M01)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.