Recombinant Human BRCC2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human BRCC2 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 2 - 108 of Human BRCC2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:VTLLPIEGQEVHFFEILESECVLYTGWIERASGSSIYPEAKARLPLEALLGSNKEPMLPKETVLSLKRYNLGSSAMKRNVPGHVLQRPSYLTRIQVTLLCNSSAEAL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
BLID
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human BRCC2 Protein

  • BH3-like motif containing, cell death inducer
  • BRCC2BH3-like motif-containing cell death inducer
  • BRCCalpha
  • breast cancer cell 2
  • Breast cancer cell protein 2
  • MGC163233
  • MGC163235

Background

BRCC2 - BRCC2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB2476
Species: Hu
Applications: WB, IHC
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NB100-148
Species: Hu, Mu, Ce, Ch
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
21340002
Species: Hu
Applications: ELISA
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-91705
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56546
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP2-43728
Species: Hu
Applications: WB, ICC/IF
NB100-416
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP
NB100-56104
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-182
Species: Hu, Mu, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, RNAi
NB100-1334
Species: Hu, Mu, Po, Bv, Ca
Applications: PEP-ELISA
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NB100-56118
Species: Hu, Mu, Rt, Ca, Ge
Applications: IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-01904
Species: Hu
Applications: WB, Flow, IHC, IHC-P

Publications for BRCC2 Partial Recombinant Protein (H00414899-Q01) (0)

There are no publications for BRCC2 Partial Recombinant Protein (H00414899-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BRCC2 Partial Recombinant Protein (H00414899-Q01) (0)

There are no reviews for BRCC2 Partial Recombinant Protein (H00414899-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BRCC2 Partial Recombinant Protein (H00414899-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional BRCC2 Products

Bioinformatics Tool for BRCC2 Partial Recombinant Protein (H00414899-Q01)

Discover related pathways, diseases and genes to BRCC2 Partial Recombinant Protein (H00414899-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BRCC2 Partial Recombinant Protein (H00414899-Q01)

Discover more about diseases related to BRCC2 Partial Recombinant Protein (H00414899-Q01).
 

Pathways for BRCC2 Partial Recombinant Protein (H00414899-Q01)

View related products by pathway.

PTMs for BRCC2 Partial Recombinant Protein (H00414899-Q01)

Learn more about PTMs related to BRCC2 Partial Recombinant Protein (H00414899-Q01).

Blogs on BRCC2

There are no specific blogs for BRCC2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

FANCD2 Antibody
NB100-182

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human BRCC2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol BLID