BPTF/FALZ Antibody


Immunocytochemistry/ Immunofluorescence: BPTF/FALZ Antibody [NBP2-57567] - Staining of human cell line U-251 MG shows localization to nucleoplasm.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF

Order Details

BPTF/FALZ Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TTIASTGQTFQITGNPVTMAGKVITKLPLPANSKIVAVNVPATQGGIVQVHQ
Specificity of human BPTF/FALZ antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (90%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for BPTF/FALZ Antibody

  • bromodomain and PHD domain transcription factor
  • Bromodomain and PHD finger-containing transcription factor
  • bromodomain PHD finger transcription factor
  • EC 3.6.1
  • EC
  • FAC1fetal Alz-50 reactive clone 1
  • FALZnucleosome-remodeling factor subunit BPTF
  • Fetal Alz-50 clone 1 protein
  • Fetal Alzheimer antigennucleosome remodeling factor, large subunit
  • NURF301


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Al, Av, Bv, Ce, Pl
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, IP
Species: Hu, Mu, Rt, Mk
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, ChIP
Species: Hu
Applications: WB, ICC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Mk
Applications: WB, DB, ELISA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
Species: Hu, Mu
Applications: WB, ChIP, IP, CHIP-SEQ
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Pm
Applications: WB, Simple Western, ChIP, ELISA, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IF
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
Species: Hu, Mu, Rt, Ca, Eq
Applications: WB
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for BPTF/FALZ Antibody (NBP2-57567) (0)

There are no publications for BPTF/FALZ Antibody (NBP2-57567).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BPTF/FALZ Antibody (NBP2-57567) (0)

There are no reviews for BPTF/FALZ Antibody (NBP2-57567). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for BPTF/FALZ Antibody (NBP2-57567). (Showing 1 - 1 of 1 FAQ).

  1. I am interesting by anti-BPTF antibody. I would like to know if a large protein like that could be revealed in PVDF membrane?
    • Regarding your question, nucleosome-remodeling factor subunit (BPTF) is a very large protein as you have also mentioned (338KD). There are some tips for efficient transfer of these proteins in western blot for instance: 1) Make sure to use a low percentage gel, for BPTF in particular I suggest you use 7% gel or even lower (5%). 2) You can use either Nitrocellulose or PVDF, to my knowledge the binding efficiency is higher for nitrocellulose while PVDF is a better choice of membrane if you are planning to do re-probing and stripping. If you are going to use PVDF, make sure to wet it in 100% methanol before use. Furthermore, PVDF membrane exhibits better binding efficiency of electroblotted material in the presence of SDS in the transfer buffer. However SDS added to facilitate transfer of large proteins should not exceed 0.05% as it will interfere with the binding of the protein to the membrane. 3) For transfer you can either use the semi-dry or wet transfer but you decide doing wet transfer, I strongly recommend you doing the transfer in low voltage (at 50v) for instance in order to obtain an efficient transfer. These are some suggestions I can provide for a better and more efficient transfer for large proteins like BPTF.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional BPTF/FALZ Products

Bioinformatics Tool for BPTF/FALZ Antibody (NBP2-57567)

Discover related pathways, diseases and genes to BPTF/FALZ Antibody (NBP2-57567). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BPTF/FALZ Antibody (NBP2-57567)

Discover more about diseases related to BPTF/FALZ Antibody (NBP2-57567).

Pathways for BPTF/FALZ Antibody (NBP2-57567)

View related products by pathway.

PTMs for BPTF/FALZ Antibody (NBP2-57567)

Learn more about PTMs related to BPTF/FALZ Antibody (NBP2-57567).

Blogs on BPTF/FALZ

There are no specific blogs for BPTF/FALZ, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our BPTF/FALZ Antibody and receive a gift card or discount.


Gene Symbol BPTF