BPHL Antibody

Images

 
Western Blot: BPHL Antibody [H00000670-B01P] - Analysis of BPHL expression in human liver.
Western Blot: BPHL Antibody [H00000670-B01P] - Analysis of BPHL expression in transfected 293T cell line by BPHL polyclonal antibody. Lane 1: BPHL transfected lysate(30.14 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

BPHL Antibody Summary

Immunogen
BPHL (NP_004323.1, 1 a.a. - 274 a.a.) full-length human protein. MPRNLLYSLLSSHLSPHFSTSVTSAKVAVNGVQLHYQQTGEGDHAVLLLPGMLGSGETDFGPQLKNLNKKLFTVVAWDPRGYGHSRPPDRDFPADFFERDAKDAVDLMKALKFKKVSLLGWSDGGITALIAAAKYPSYIHKMVIWGANAYVTDEDSMIYEGIRDVSKWSERTRKPLEALYGYDYFARTCEKWVDGIRQFKHLPDGNICRHLLPRVQCPALIVHGEKDPLVPRFHADFIHKHVKGSRLHLMPEGKHNLHLRFADEFNKLAEDFLQ
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
BPHL
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for BPHL Antibody

  • biphenyl hydrolase-like (serine hydrolase)
  • Biphenyl hydrolase-like protein
  • Biphenyl hydrolase-related protein
  • Bph-rp
  • Breast epithelial mucin-associated antigen
  • EC 3.1
  • MCNAA
  • MGC125930
  • MGC41865
  • VACVASE
  • valacyclovir hydrolase
  • valacyclovirase

Background

The serine hydrolases, including BPHL, are defined as a functional class of hydrolytic enzymes that contain a serine residue in their active site. They can be grouped into subfamilies that contain closely related members in terms of substrate specificity or amino acid sequence similarity (Puente and Lopez-Otin, 1995 [PubMed 7759552]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92005
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-45600
Species: Hu, Ca, Mk
Applications: WB, IHC, IF
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-85543
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85691
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-15771
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF4036
Species: Hu
Applications: WB, Simple Western
NBP2-02948
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00347527-B01P
Species: Hu
Applications: WB, ELISA
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-82527
Species: Hu
Applications: IHC, IHC-P
NBP1-92498
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00004502-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-97841
Species: Hu
Applications: IP (-), WB
NBP1-06983
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP, PEP-ELISA
AF2396
Species: Hu
Applications: WB, Simple Western, IHC

Publications for BPHL Antibody (H00000670-B01P) (0)

There are no publications for BPHL Antibody (H00000670-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for BPHL Antibody (H00000670-B01P) (0)

There are no reviews for BPHL Antibody (H00000670-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for BPHL Antibody (H00000670-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional BPHL Products

Bioinformatics Tool for BPHL Antibody (H00000670-B01P)

Discover related pathways, diseases and genes to BPHL Antibody (H00000670-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for BPHL Antibody (H00000670-B01P)

Discover more about diseases related to BPHL Antibody (H00000670-B01P).
 

Pathways for BPHL Antibody (H00000670-B01P)

View related products by pathway.

Blogs on BPHL

There are no specific blogs for BPHL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our BPHL Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol BPHL
Uniprot